DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or67b

DIOPT Version :10

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:153 Identity:30/153 - (19%)
Similarity:67/153 - (43%) Gaps:17/153 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 RLLDYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLFFVGDTISLVY-----YLV 290
            ||...|..|      ||.:......:.|||   |..: .|::..:|:.:...:.:.:     .:|
  Fly   275 RLFARISSH------HNQIENLFKYIILVQ---CSVS-SILICMLLYKISTVLEVGWVWMGMIMV 329

  Fly   291 FFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQLTLGNRGWIIKAGG 355
            :|..:.:::......|.:|..:.|.|.:..::..||::||:.:|  :|...|....|.:::..||
  Fly   330 YFVTIALEITLYNVSAQKVESQSELLFHDWYNCSWYNESREFKF--MIKMMLLFSRRTFVLSVGG 392

  Fly   356 LIELNLNAFFATLKMAYSLFAVV 378
            ...|:........:::.:.|.::
  Fly   393 FTSLSHKFLVQVFRLSANFFLLL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 29/145 (20%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 29/144 (20%)

Return to query results.
Submit another query.