DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or59c

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:368 Identity:77/368 - (20%)
Similarity:145/368 - (39%) Gaps:46/368 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LLHILVTLWFPLHLLLHLLLLP--------------STAEFFKNLTMSLTCVACSLKHVAHLYHL 88
            ||..:.:||....:.|.::.||              :..||..:|.:.:.|:...:|.......:
  Fly    43 LLRWIYSLWTLTTMWLGIVYLPLGLSLTYVKHFDRFTPTEFLTSLQVDINCIGNVIKSCVTYSQM 107

  Fly    89 PQIVEIESLIEQLDTFIASEQEHRYYRDHVHCHARRFTRCLYISFGMIYALFLF-GVFVQVISGN 152
            .:...:..||..||....:..:.|.:...|   ||  ...:.|.|...|..|.| .:|..|.:|.
  Fly   108 WRFRRMNELISSLDKRCVTTTQRRIFHKMV---AR--VNLIVILFLSTYLGFCFLTLFTSVFAGK 167

  Fly   153 --WELLYPAYFPFDLESNRFLGAVA--LGYQVFSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSI 213
              |:|..|.   .|.....:...:|  |.|.|.|  :...|.|.:|||..:.:.|...|:.:...
  Fly   168 APWQLYNPL---VDWRKGHWQLWIASILEYCVVS--IGTMQELMSDTYAIVFISLFRCHLAILRD 227

  Fly   214 RMGQLGYFDDETVVNH-QRLLDYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLF 277
            |:..|......:.:.| ::::..|:.|:.:::...::...:|.....|....|..|.:....:||
  Fly   228 RIANLRQDPKLSEMEHYEQMVACIQDHRTIIQCSQIIRPILSITIFAQFMLVGIDLGLAAISILF 292

  Fly   278 FVGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIF--- 339
            |.....:::..:.|...:|.:.||.|.....:.|:...:..|:|.|.|....|.::..:|.|   
  Fly   293 FPNTIWTIMANVSFIVAICTESFPCCMLCEHLIEDSVHVSNALFHSNWITADRSYKSAVLYFLHR 357

  Fly   340 ----TQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVV 378
                .|.|         ||.:..:::.:..|..|.|:::..:|
  Fly   358 AQQPIQFT---------AGSIFPISVQSNIAVAKFAFTIITIV 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 68/324 (21%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 68/324 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.