DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or59b

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster


Alignment Length:408 Identity:96/408 - (23%)
Similarity:170/408 - (41%) Gaps:76/408 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SLSFYRPFWICMRLLVPTFFKDSSRPVQLYVVLLHILVTLWFPLHLLLHLLLLP-----STAEFF 65
            ::..||..|: :..:.|      ...|..||.|      .|..:.....:..||     |..:.|
  Fly    22 NIYLYRAMWL-IGWIPP------KEGVLRYVYL------FWTCVPFAFGVFYLPVGFIISYVQEF 73

  Fly    66 KN------LTMSLTCV---ACSLKHVAHLYHLPQIVEIESLIEQLDTFIASEQEHRYYRDHVHCH 121
            ||      ||....|:   ..|:|.......|.::.:.|.|::.||..:|::.:    |:.:|  
  Fly    74 KNFTPGEFLTSLQVCINVYGASVKSTITYLFLWRLRKTEILLDSLDKRLANDSD----RERIH-- 132

  Fly   122 ARRFTRCLY--ISFGMIYALFLFGVFVQ-VISGN--WELLYPAYFPF----DLESNRFLGAVALG 177
             ....||.|  :.:..||..:....|:. .:||.  |.:    |.||    |...:.::.|:   
  Fly   133 -NMVARCNYAFLIYSFIYCGYAGSTFLSYALSGRPPWSV----YNPFIDWRDGMGSLWIQAI--- 189

  Fly   178 YQVFSMLVEGFQGLGNDTYTPLTLCLLAGHV-----HLWSIRMGQLGYFDDE--TVVNHQRLLDY 235
            ::..:|.....|...:|||..:...:...|:     |:.|:||      |.|  ...|:|.|::.
  Fly   190 FEYITMSFAVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRM------DPERSEADNYQDLVNC 248

  Fly   236 IEQHKLLVR----FHNLVSRTISEVQLVQLGG-CGATLCIIVSYMLFFVGDTISLVYYLVFFGVV 295
            :..||.:::    ...::||||. ||...:|. .|.||..:..:..|:.|     |..|:|...:
  Fly   249 VLDHKTILKCCDMIRPMISRTIF-VQFALIGSVLGLTLVNVFFFSNFWKG-----VASLLFVITI 307

  Fly   296 CVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQLTLGNRGWIIKAGGLIELN 360
            .:|.||.||..:.:.::.:.|...||.|.|.|....::..|::|....  .:..|..|||:..::
  Fly   308 LLQTFPFCYTCNMLIDDAQDLSNEIFQSNWVDAEPRYKATLVLFMHHV--QQPIIFIAGGIFPIS 370

  Fly   361 LNAFFATLKMAYSLFAVV 378
            :|:.....|.|:|:..:|
  Fly   371 MNSNITVAKFAFSIITIV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 82/341 (24%)
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 78/332 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.