DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or56a

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:453 Identity:91/453 - (20%)
Similarity:150/453 - (33%) Gaps:146/453 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLVPTFF--------------------KDSSRPVQLYVVLLHILVTLWFPLHLLLHLLLLPSTAE 63
            ||.||.|                    ||.:||:...:....:..::|     |...|:|.....
  Fly     8 LLSPTTFEDPIFGTHLRYFQWYGYVASKDQNRPLLSLIRCTILTASIW-----LSCALMLARVFR 67

  Fly    64 FFKNLTMSLTCVA----------------------CSLKHVAHLYHLPQIVEIESLIEQLDT--- 103
            .::||....|..|                      .||..|||       .:|::|:.:.|.   
  Fly    68 GYENLNDGATSYATAVQYFAVSIAMFNAYVQRDKVISLLRVAH-------SDIQNLMHEADNREM 125

  Fly   104 --FIASEQEHR-----YYRDHVHCHARRFTRCLYISFG-------------------MIYALFLF 142
              .:|::...|     .:...|......::.|:|.|..                   :::.||.|
  Fly   126 ELLVATQAYTRTITLLIWIPSVIAGLMAYSDCIYRSLFLPKSVFNVPAVRRGEEHPILLFQLFPF 190

  Fly   143 GV----FVQVISGNWELL------YPAYFPFDLESNRFLGAVALGYQVFSMLVEGFQGLGNDTYT 197
            |.    ||....|.|..|      .|.:..|   ....:..|.|..|:.:..||...      .|
  Fly   191 GELCDNFVVGYLGPWYALGLGITAIPLWHTF---ITCLMKYVNLKLQILNKRVEEMD------IT 246

  Fly   198 PLTLCLLAGHVHLWSIRMGQLGYFDDETVVNHQRLLDYIEQHKLLVRFHNLVSRTISEVQLVQLG 262
            .|...|:.|.:....:...|:..| .|.|....|:..::::.:.|:....:....|..|      
  Fly   247 RLNSKLVIGRLTASELTFWQMQLF-KEFVKEQLRIRKFVQELQYLICVPVMADFIIFSV------ 304

  Fly   263 GCGATLCIIVSYMLFF---VGDTISLVYYLVFFGVVCVQLFPSC-------YFASEVAEELERLP 317
                .:|     .|||   ||....:.|:.:|     :.||...       :.|:.:.|..:.|.
  Fly   305 ----LIC-----FLFFALTVGVPSKMDYFFMF-----IYLFVMAGILWIYHWHATLIVECHDELS 355

  Fly   318 YAIFSSRWYDQSRDHRFD-----LLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLF 375
            .|.||..||:      |:     :|:|..:. ..|...::| .|::|||..|....:.|||.|
  Fly   356 LAYFSCGWYN------FEMPLQKMLVFMMMH-AQRPMKMRA-LLVDLNLRTFIDIGRGAYSYF 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 74/387 (19%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 62/318 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.