DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or49a

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:332 Identity:74/332 - (22%)
Similarity:138/332 - (41%) Gaps:53/332 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VACSLKHVAHLYHLPQIVEIESLIEQLDTFIASEQEHRYY---RDHVHCHARRFTRCLYISFGMI 136
            ::..||.:..:.:..:::::...:::|  :...||..|.|   :.::.|..|   ..||:.:.::
  Fly    84 LSSQLKFITFMINRKRLLQLSHRLKEL--YPHKEQNQRKYEVNKYYLSCSTR---NVLYVYYFVM 143

  Fly   137 YALFLFGVFVQVIS-----GNWELLYPAYFPFDL--ESNRFLGAVALGYQV---FSMLVEGFQGL 191
            ..:.|..:....|.     |..:..|...||..|  :|.:.||.| |.|.:   :|..:... .|
  Fly   144 VVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPLGYV-LAYVIDFTYSQFIVNV-SL 206

  Fly   192 GNDTYTPLTLCLLAGHVHLWSIRMGQLGYF---------DDETVVNHQRLLDY----IEQHKLLV 243
            |.|.:   .:|:.:      .|.| .|||.         ..||   .|:..|:    |::|:|::
  Fly   207 GTDLW---MMCVSS------QISM-HLGYLANMLASIRPSPET---EQQDCDFLASIIKRHQLMI 258

  Fly   244 RFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLF--FVGDTISLVYYLVFFGVVCVQLFPSCYFA 306
            |....|:.....:....|......||.:..|.:.  |..:.||   |::.|..|..|.:......
  Fly   259 RLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGIS---YMMLFASVAAQFYVVSSHG 320

  Fly   307 SEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMA 371
            ..:.:....|..|.|.|:||:.|..::.::||.  :....|...|.|.|:|.::|:.|...:.:.
  Fly   321 QMLIDLSTNLAKAAFESKWYEGSLRYKKEILIL--MAQAQRPLEISARGVIIISLDTFKILMTIT 383

  Fly   372 YSLFAVV 378
            |..|||:
  Fly   384 YRFFAVI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 70/324 (22%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 70/320 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.