DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or45b

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:417 Identity:93/417 - (22%)
Similarity:155/417 - (37%) Gaps:98/417 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YVVLLHILVTLWFPLHLL----------LHLLLLP---------STAEF---FKNLTMS------ 71
            |.:..|:.....:...||          ||||.|.         ..|||   :.:|..|      
  Fly    10 YPLAKHLFFVTRYSFGLLGLRFGKEQSWLHLLWLVFNFVNLAHCCQAEFVFGWSHLRTSPVDAMD 74

  Fly    72 ----LTCVACSLKHVAHLYHLPQIVEIESLIEQLDTFIASEQEHRYYRDHVHCHARR-----FTR 127
                |.|...:|..:..::...|  |:..|::::...|..:::....|..|   |:|     .||
  Fly    75 AFCPLACSFTTLFKLGWMWWRRQ--EVADLMDRIRLLIGEQEKREDSRRKV---AQRSYYLMVTR 134

  Fly   128 C--LYISFGMIYALFLFGVFVQVISGNWELLYPAY--FPFDLESNRFLGAVA---LGYQVF---- 181
            |  |..:.|.|..    |.|  |:...||:....:  |.||:.........|   ..:.||    
  Fly   135 CGMLVFTLGSITT----GAF--VLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPVFYLYS 193

  Fly   182 ----SMLVEGFQG-----LGNDTYTPLTLCLLAGHVH--LWSIRMGQLGYFDDETVVNHQRLLDY 235
                .:.|..|.|     .|...|....|..|...:.  |..||...|    .|:.:..|||.|.
  Fly   194 TWSGQVTVYAFAGTDGFFFGFTLYMAFLLQALRYDIQDALKPIRDPSL----RESKICCQRLADI 254

  Fly   236 IEQH----KLLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLFFVGDTISLVYYLVFFGVVC 296
            :::|    |::..|..:::.. :.|..|     .|:|.|..|.:...:....:::.|:|:...|.
  Fly   255 VDRHNEIEKIVKEFSGIMAAP-TFVHFV-----SASLVIATSVIDILLYSGYNIIRYVVYTFTVS 313

  Fly   297 VQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQLTLGNRGWIIKAGGLIELNL 361
            ..:|..||..:|::.|...|..|.:||.||...|:.|..:.:.          |::|...|.:.:
  Fly   314 SAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLI----------ILRAQRPITVRV 368

  Fly   362 NAFFATLKMAYSLF----AVVVRAKGI 384
            ..|..:|.:..|:.    ::|..||.|
  Fly   369 PFFAPSLPVFTSVIKFTGSIVALAKTI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 79/355 (22%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 76/348 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465135
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.