DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or43a

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster


Alignment Length:393 Identity:86/393 - (21%)
Similarity:148/393 - (37%) Gaps:82/393 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LLHILVTLWFPLHLLLHLLLLPSTAEFFKNLTMSLTCVACSLKHVAHLYH----LPQIV------ 92
            |:.|.|.:|  .||   .:|.|:....::.....|...|.:|....:|..    ||..:      
  Fly     8 LVGINVRMW--RHL---AVLYPTPGSSWRKFAFVLPVTAMNLMQFVYLLRMWGDLPAFILNMFFF 67

  Fly    93 ------------------EIESLIEQLDTFIAS--EQEHRYYRDHVHCHARRFTRCLYI-----S 132
                              :.|..:.||.|...|  :....:.|..:. .|.|..|.|.|     |
  Fly    68 SAIFNALMRTWLVIIKRRQFEEFLGQLATLFHSILDSTDEWGRGILR-RAEREARNLAILNLSAS 131

  Fly   133 F-----GMIYALFL------FGVFVQVISGN----WELLYPAYFPFDLESNRFLGAVALGYQVFS 182
            |     .::..||.      ||:.:..:|..    :|::|.|..|..|       .:::.|..|.
  Fly   132 FLDIVGALVSPLFREERAHPFGLALPGVSMTSSPVYEVIYLAQLPTPL-------LLSMMYMPFV 189

  Fly   183 MLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQLGYFDDETVVNHQRLLDYIEQHKLLVRFHN 247
            .|..|....|.        .:|...||    |:||:|..:.......|||...|..|..::|:..
  Fly   190 SLFAGLAIFGK--------AMLQILVH----RLGQIGGEEQSEEERFQRLASCIAYHTQVMRYVW 242

  Fly   248 LVSRTISEVQLVQLGGCGATLCIIVSYMLFFVGDT--ISLVYYLVFFGVVCVQLFPSCYFASEVA 310
            .:::.::.:..|:....|:.:|.::..:......|  ||:|.|::   .:...||.....|:|:.
  Fly   243 QLNKLVANIVAVEAIIFGSIICSLLFCLNIITSPTQVISIVMYIL---TMLYVLFTYYNRANEIC 304

  Fly   311 EELERLPYAIFSSRWYDQSRDHRFDLLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLF 375
            .|..|:..|:::..||:.....|..||||...|  .....|:.|.:..:.|..|.:.|..:||.|
  Fly   305 LENNRVAEAVYNVPWYEAGTRFRKTLLIFLMQT--QHPMEIRVGNVYPMTLAMFQSLLNASYSYF 367

  Fly   376 AVV 378
            .::
  Fly   368 TML 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 75/363 (21%)
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 71/332 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465764
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.