DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or42b

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:367 Identity:91/367 - (24%)
Similarity:169/367 - (46%) Gaps:47/367 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YVVLLHILVT-LWFPLHLLLHLL-------LLPSTAEFFKNLTMSLTCVACSLKHVAHLYH-LPQ 90
            ||.|...|:| :|...:|.|..|       ...|..||..:|.:.:.....|:| ||..|. |.:
  Fly    43 YVYLTWTLMTFVWCTTYLPLGFLGSYMTQIKSFSPGEFLTSLQVCINAYGSSVK-VAITYSMLWR 106

  Fly    91 IVEIESLIEQLDTFIASEQEHRYYRDHVHCHARRFTRCLYISFGMIYALFLFGVFV-QVISGN-- 152
            :::.:::::|||....:.:|    |:.:|....|.... ::.|..:|..:....:: .|:||.  
  Fly   107 LIKAKNILDQLDLRCTAMEE----REKIHLVVARSNHA-FLIFTFVYCGYAGSTYLSSVLSGRPP 166

  Fly   153 WELLYPAYFPF-DLESN--RFLGAVALGYQVFSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIR 214
            |:|    |.|| |....  :...|..|.|.|.|..|  .|...:|:|..:...:|..|:.:...|
  Fly   167 WQL----YNPFIDWHDGTLKLWVASTLEYMVMSGAV--LQDQLSDSYPLIYTLILRAHLDMLRER 225

  Fly   215 MGQLGYFDDETV---VNHQRLLDYIEQHKLLVRFHNLVSRTISE---VQLVQLGGCGATLCIIVS 273
            :.:|.  .||.:   .:::.|:..:..|||::|:..::...|..   .|.:.:|       :::.
  Fly   226 IRRLR--SDENLSEAESYEELVKCVMDHKLILRYCAIIKPVIQGTIFTQFLLIG-------LVLG 281

  Fly   274 YML---FFVGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFD 335
            :.|   ||..|..:.:...:|...:.:|.||.||..:.:.|:.|.|.:|||.|.|.|.||.::..
  Fly   282 FTLINVFFFSDIWTGIASFMFVITILLQTFPFCYTCNLIMEDCESLTHAIFQSNWVDASRRYKTT 346

  Fly   336 LLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAV 377
            ||.|.|..  .:..:..|||:.::::::..:..|.|:|:..:
  Fly   347 LLYFLQNV--QQPIVFIAGGIFQISMSSNISVAKFAFSVITI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 80/327 (24%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 80/327 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468609
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.