DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or42a

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster


Alignment Length:407 Identity:95/407 - (23%)
Similarity:173/407 - (42%) Gaps:64/407 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MRLLVPTFF---KDS---SRPVQLYVV------------------------LLHILVTLWFPLHL 51
            :|...||.:   |||   ||...||::                        .|:...|.:.|:..
  Fly     3 LRRWFPTLYTQSKDSPVRSRDATLYLLRCVFLMGVRKPPAKFFVAYVLWSFALNFCSTFYQPIGF 67

  Fly    52 LL----HLLLLPSTAEFFKNLTMSLTCVACSLKHVAHLYHLPQIVEIESLIEQLDTFIASEQEHR 112
            |.    ||... |..||..:|.::....:||.|.:.....:.:..|..:|::::|..|....|..
  Fly    68 LTGYISHLSEF-SPGEFLTSLQVAFNAWSCSTKVLIVWALVKRFDEANNLLDEMDRRITDPGERL 131

  Fly   113 YYRDHVHCHARRFTRCLYISFGMIYA--LFLFGVFVQVISGNWELLYPAYFPF-DLESNRFLGAV 174
            .....|....|.|  ..:::..|:||  .||..:|:      ....|..|:|| |..|:....|:
  Fly   132 QIHRAVSLSNRIF--FFFMAVYMVYATNTFLSAIFI------GRPPYQNYYPFLDWRSSTLHLAL 188

  Fly   175 ALGYQVFSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQLGYFDDET-VVNHQRLLDYIEQ 238
            ..|.:.|:|....||.:..|.|....:.:|..|:.:::.|:.:||.:..|: ...::||:..|:.
  Fly   189 QAGLEYFAMAGACFQDVCVDCYPVNFVLVLRAHMSIFAERLRRLGTYPYESQEQKYERLVQCIQD 253

  Fly   239 HKLLVRFHNLVSRTISEVQLVQLGGCGATL-CIIVSYMLFF-VGDTISLVYYLVFFGVVCVQLFP 301
            ||:::||.:.:...||....||....|..| ..:::.:||. :|..|:.   |.|...|.::..|
  Fly   254 HKVILRFVDCLRPVISGTIFVQFLVVGLVLGFTLINIVLFANLGSAIAA---LSFMAAVLLETTP 315

  Fly   302 SCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQ-----LTLGNRGWIIKAGGLIELNL 361
            .|...:.:.|:..:|..|:|.|.|.|:.:.::..|:.|.|     :|       ..|..:..:::
  Fly   316 FCILCNYLTEDCYKLADALFQSNWIDEEKRYQKTLMYFLQKLQQPIT-------FMAMNVFPISV 373

  Fly   362 NAFFATLKMAYSLFAVV 378
            ....:..|.::|:|.:|
  Fly   374 GTNISVTKFSFSVFTLV 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 76/322 (24%)
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 76/322 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.