DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or22b

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:362 Identity:82/362 - (22%)
Similarity:154/362 - (42%) Gaps:52/362 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LWFPLHLLLHLLLLP--------------STAEFFKNLTMSLTCVACSLKHVAHLYHLPQIVEIE 95
            ||.....||..:|||              |..||..::.:.:.....|.|....:....:..|.:
  Fly    50 LWSTFVTLLIFILLPISVSVEYIQRFKTFSAGEFLSSIQIGVNMYGSSFKSYLTMMGYKKRQEAK 114

  Fly    96 SLIEQLDTFIASEQEHRYYRDHVHCHARRFTRCLYISFGMIYALFLFGVFVQVISGN---WELLY 157
            ..:::||.....::|    |..||.|......| ||.:.:.|..||...|:..|...   |.:  
  Fly   115 MSLDELDKRCVCDEE----RTIVHRHVALGNFC-YIFYHIAYTSFLISNFLSFIMKRIHAWRM-- 172

  Fly   158 PAYFPF-DLESNRFLGAVALGYQVFSMLVEG---FQGLGNDTYTPLTLCLLAGHVHLWSIRMGQL 218
              |||: |.|...::.::|      .:::.|   |..|..|....:::.:...|:.|...|:..|
  Fly   173 --YFPYVDPEKQFYISSIA------EVILRGWAVFMDLCTDVCPLISMVIARCHITLLKQRLRNL 229

  Fly   219 ----GYFDDETVVNHQRLLDYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLFFV 279
                |..:||.:   :.|.|.:..|:|::.:.:.:....|....||....|..|.:.:..::|| 
  Fly   230 RSEPGRTEDEYL---KELADCVRDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFF- 290

  Fly   280 GDTISL-VYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQLT 343
             .|:|. |..::|...|.:|.||.||..:.:.::.:.:..::|.|.|....|.::..|:.|    
  Fly   291 -STLSTGVAVVLFMSCVSMQTFPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYF---- 350

  Fly   344 LGN--RGWIIKAGGLIELNLNAFFATLKMAYSLFAVV 378
            |.|  :..|:.|||:..:::......:|:|:::..:|
  Fly   351 LHNLQQPIILTAGGVFPISMQTNLNMVKLAFTVVTIV 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 73/325 (22%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 72/323 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.