DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or22a

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster


Alignment Length:365 Identity:81/365 - (22%)
Similarity:154/365 - (42%) Gaps:41/365 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PVQLYVVLLHILVTLWFPLHL---LLHLLLLPSTAEFFKNLTMSLTCVACSLKHVAHLYHLPQIV 92
            |.:|::..::|::.:..|:.:   .||.....|..||..:|.:.:.....|.|....|....:..
  Fly    47 PYKLWLAFVNIVMLILLPISISIEYLHRFKTFSAGEFLSSLEIGVNMYGSSFKCAFTLIGFKKRQ 111

  Fly    93 EIESLIEQLDTFIASEQE----HRYYRDHVHCHARRFTRCLYISFGMIYALFLFGVFVQVISGNW 153
            |.:.|::|||....|::|    |||..      ...|...||..|...:.:..|..|:......|
  Fly   112 EAKVLLDQLDKRCLSDKERSTVHRYVA------MGNFFDILYHIFYSTFVVMNFPYFLLERRHAW 170

  Fly   154 ELLYPAYFPF-DLESNRFLGAVALGYQVFSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQ 217
            .:    |||: |.:...::.::|   :.|.|....:..|..|....:::.:...|:.|...|:..
  Fly   171 RM----YFPYIDSDEQFYISSIA---ECFLMTEAIYMDLCTDVCPLISMLMARCHISLLKQRLRN 228

  Fly   218 L----GYFDDETVVNHQRLLDYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLFF 278
            |    |..:||.:   :.|.:.|..|:||:.:.:.:....|....||....|..|.:.:..::||
  Fly   229 LRSKPGRTEDEYL---EELTECIRDHRLLLDYVDALRPVFSGTIFVQFLLIGTVLGLSMINLMFF 290

  Fly   279 VGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQ-- 341
            ......:...|..|. |.::.||.||..:.:.::.:.:...:|.|.|....|.::..|:.|..  
  Fly   291 STFWTGVATCLFMFD-VSMETFPFCYLCNMIIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLHNL 354

  Fly   342 ---LTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVV 378
               :||       .|||:..:::....|.:|:|:|:..|:
  Fly   355 QQPITL-------TAGGVFPISMQTNLAMVKLAFSVVTVI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 72/325 (22%)
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 71/323 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468613
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.