DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or10a

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:390 Identity:78/390 - (20%)
Similarity:128/390 - (32%) Gaps:117/390 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WICMR--LLVPTFFKDSSRPVQLYVVLLHILVTLWFPLHLLLHLLLLPSTAEFFKNLTMSLTCVA 76
            |..:|  |..|.:.:...|.::|....:...:..|            |.:|.||       ||..
  Fly   105 WNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFW------------PLSAGFF-------TCTT 150

  Fly    77 CSLKHVAHLYHLPQIVEIESLIEQLDTFIASEQEHRYYRDHVHCHARRFTRCLYISFGMIYALFL 141
            .:||.:.    :..|:.:::                .|.|.|          .:..|.|.....|
  Fly   151 YNLKPIL----IAMILYLQN----------------RYEDFV----------WFTPFNMTMPKVL 185

  Fly   142 FGVFVQVISGNWELLYPAYFPFDLESNRFLGAVAL-------GYQV-----FSMLVEGFQGLGND 194
                         |.|| :||.......:.|.|.:       |:..     .|.|.|..|.....
  Fly   186 -------------LNYP-FFPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIES 236

  Fly   195 TYTPLTLCLLAGHVHLWSIRMGQLGYFDDETVVNHQRLLD---YIEQHKLLVRFHNLVSRTI--- 253
            .:.|.|     .|:.|..:::..|.......::.|..::|   :......::...:.||..:   
  Fly   237 MFRPYT-----DHLELSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIG 296

  Fly   254 -SEVQLVQLG--GCGATLCIIVSYMLFFVGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELER 315
             |.|.|:.||  |.||.|     |:.:.|.....|:.|              ||..:.|||....
  Fly   297 FSMVNLLTLGNNGLGAML-----YVAYTVAALSQLLVY--------------CYGGTLVAESSTG 342

  Fly   316 LPYAIFSSRW--YDQSRDHRFDLLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVV 378
            |..|:||..|  :...:.....|||     |.::..:..|......:|..|.|.|:.:.|:.|:|
  Fly   343 LCRAMFSCPWQLFKPKQRRLVQLLI-----LRSQRPVSMAVPFFSPSLATFAAILQTSGSIIALV 402

  Fly   379  378
              Fly   403  402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 67/334 (20%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 75/382 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465117
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.