DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or82a

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:386 Identity:82/386 - (21%)
Similarity:146/386 - (37%) Gaps:105/386 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SLTCVACSLKHVAHL-------YHLPQIV-----EIESL-------------IEQLDTFIASEQE 110
            |....|.||||::.|       |.|...|     ::|.:             :.::.||:|:.::
  Fly    23 STDSTALSLKHISSLIFVISAQYPLISYVAYNRNDMEKVTACLSVVFTNMLTVIKISTFLANRKD 87

  Fly   111 -----HRYYRDHVH--CHARRFT-----------------RCLYISFGMIYALFLFGVFVQVISG 151
                 ||:.:.|..  .|..|:.                 |...:|.|:....|:.|..|::...
  Fly    88 FWEMIHRFRKMHEQSASHIPRYREGLDYVAEANKLASFLGRAYCVSCGLTGLYFMLGPIVKIGVC 152

  Fly   152 NW-------ELLYPAYFPF-DLESNRFLGAVALGYQV-------FSMLVEGFQGLGNDTYTPLTL 201
            .|       ||..|..||| ||||.        ||:|       .:::|..:....:..:....:
  Fly   153 RWHGTTCDKELPMPMKFPFNDLESP--------GYEVCFLYTVLVTVVVVAYASAVDGLFISFAI 209

  Fly   202 CL------LAGHVHLWSIRMGQLGYFDDETVVNHQRLLDYIEQHKLLV----RFHNLVSRTIS-- 254
            .|      |...:..|.....     :.:|.:   ||...:|.|.||:    :..::.:.|:.  
  Fly   210 NLRAHFQTLQRQIENWEFPSS-----EPDTQI---RLKSIVEYHVLLLSLSRKLRSIYTPTVMGQ 266

  Fly   255 -EVQLVQLGGCGATLCIIVSYMLFFVGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPY 318
             .:..:|:|       :|:..::..:...:.|:.|..|||.:.:|||..||....:..|..::..
  Fly   267 FVITSLQVG-------VIIYQLVTNMDSVMDLLLYASFFGSIMLQLFIYCYGGEIIKAESLQVDT 324

  Fly   319 AIFSSRWYDQSRDHRFDL-LIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVV 378
            |:..|.|:..|...|..| ||..|   ..:..:|:||..: .:|..|....:.|.||..::
  Fly   325 AVRLSNWHLASPKTRTSLSLIILQ---SQKEVLIRAGFFV-ASLANFVGICRTALSLITLI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 79/378 (21%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 68/335 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.