DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or65b

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster


Alignment Length:441 Identity:82/441 - (18%)
Similarity:149/441 - (33%) Gaps:111/441 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSFYRPFWICMR--LLVPT-----FFKDSSRPVQLYVVLLHILVTLWFPLHLLLHLLLLPSTAEF 64
            |.||:..|...|  |:..:     ::::..:.:.|:......|:    |.....|.|:......|
  Fly     7 LKFYKVGWKTYRDPLMEASHSSIYYWREQMKAMALFTTTEERLL----PYRSKWHTLVYIQMVIF 67

  Fly    65 FKNLTMSLTCVACSLKHVAHLYHLPQIV-----------------EIESLIEQLDTF-------- 104
            |.:::..||  .....||.....|..|:                 |::.:|..||..        
  Fly    68 FASMSFGLT--ESMGDHVQMGRDLAFILGAFFIIFKTYYFCWYGDELDQVISDLDALHPWAQKGP 130

  Fly   105 --IASEQEHRYYRDHVHCHARRFTRCLYISFGMIYALFLFGVFVQVISGNW----ELLYPAYFPF 163
              :..:...|:|          |....:::....:.|.:. :.:.:.|..|    .|.:.|.|||
  Fly   131 NPVEYQTGKRWY----------FVMAFFLATSWSFFLCIL-LLLLITSPMWVHQQNLPFHAAFPF 184

  Fly   164 DLESNR-----------FLGAVALGYQVFSMLVEGFQGLGNDTYTPLT-----LCLLAGHVHLWS 212
            ......           |....|:....:.:.:|   ||....|..:|     |||....:|..:
  Fly   185 QWHEKSLHPISHAIIYLFQSYFAVYCLTWLLCIE---GLSICIYAEITFGIEVLCLELRQIHRHN 246

  Fly   213 IRMGQLGYFDDETVVNHQRLLDYIEQ-----HKLL-----VRFHNLVSRTISEVQLVQLGGCGAT 267
            ..:.:|....:..|..||::::.:::     |..|     |.| :|||  :|.::.|:.......
  Fly   247 YGLQELRMETNRLVKLHQKIVEILDRTNDVFHGTLIMQMGVNF-SLVS--LSVLEAVEARKDPKV 308

  Fly   268 LCIIVSYMLFFVGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQ---S 329
            :......||..:|       :|..:.....||.......||.|.|.            ||.   |
  Fly   309 VAQFAVLMLLALG-------HLSMWSYCGDQLSQKSLQISEAAYEA------------YDPTKGS 354

  Fly   330 RDHRFDLLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVVVR 380
            :|...||.:.  :..|....|::|......||..:.|.|...|.:...:::
  Fly   355 KDVYRDLCVI--IRRGQDPLIMRASPFPSFNLINYSAILNQCYGILTFLLK 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 70/371 (19%)
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 65/349 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465225
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.