DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or2a

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:370 Identity:102/370 - (27%)
Similarity:182/370 - (49%) Gaps:33/370 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LYVVLLHILVTLWFPLHLLLHLLLLPSTAEFFKNLTMSLTCVACSLKHVAHLYHL-PQIVEIESL 97
            :|.:.::::||:.|||.||..||...:.|...:|||:::|.:..:|| .|::|.: .|:.||.||
  Fly    40 VYSITVNLVVTVLFPLSLLARLLFTTNMAGLCENLTITITDIVANLK-FANVYMVRKQLHEIRSL 103

  Fly    98 IEQLDT---FIASEQEHRYYRDHVHCHARRFTRCLYISFGMIYALFLFGVFVQ----VISGNWEL 155
            :..:|.   .:...:|....|..|:....        :|....::|:||..:.    |:..:.||
  Fly   104 LRLMDARARLVGDPEEISALRKEVNIAQG--------TFRTFASIFVFGTTLSCVRVVVRPDREL 160

  Fly   156 LYPAYFPFD-LESNRFLGAVALGYQVFSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQLG 219
            ||||:|..| :.|.|....:.: ||:|.::|:..|...:|:|.|..||||.||:....:|:.::|
  Fly   161 LYPAWFGVDWMHSTRNYVLINI-YQLFGLIVQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIG 224

  Fly   220 YFDDETVVN----------HQRLLDYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSY 274
            ...:::...          :|.|::.|.....:.|...::.|.:|...:.|.....|..|.:..:
  Fly   225 CRTEKSNKGQTYEAWREEVYQELIECIRDLARVHRLREIIQRVLSVPCMAQFVCSAAVQCTVAMH 289

  Fly   275 MLFFVG--DTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLL 337
            .|:...  |..:::..:|||..|.:::|..|||...:..:.|.|..|.:...|.:|....:.:||
  Fly   290 FLYVADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELL 354

  Fly   338 IFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVVVRAK 382
             || |....|..:|.||..|.|:|..|...::..||:|.:::|||
  Fly   355 -FT-LARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLLLRAK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 86/332 (26%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 86/332 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I7421
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 1 1.000 - - FOG0008557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.