DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and Or19b

DIOPT Version :9

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster


Alignment Length:368 Identity:78/368 - (21%)
Similarity:157/368 - (42%) Gaps:61/368 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VLLHILVTLWFPLHLLLHLLLLPSTAEFFKNLTMSLTCVACSLKHVAHLYHL-------PQIVEI 94
            |..||.:.:.|.::||..    .|...|.::|     ||  ::.|..::..|       .:::..
  Fly    46 VTFHICIWVSFSVNLLQS----NSLETFCESL-----CV--TMPHTLYMLKLINVRRMRGEMISS 99

  Fly    95 ESLIEQLDTFIASEQEHRYYRDHVHCHARRFTRCLY------ISFGMIYALFLFGVFVQVISGNW 153
            ..|:..||..:....|.:.....:. .|....|.::      :..|:||           ||.:.
  Fly   100 HWLLRLLDKRLGCADERQIIMAGIE-RAEFIFRTIFRGLACTVVLGIIY-----------ISASS 152

  Fly   154 E--LLYPAYFPFDLE--SNRFLGAVALGYQVFSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIR 214
            |  |:||.:.|::.:  ::.:|....|  ...:::......|...:|....|.|::.|....::|
  Fly   153 EPTLMYPTWIPWNWKDSTSAYLATAML--HTTALMANATLVLNLSSYPGTYLILVSVHTKALALR 215

  Fly   215 MGQLGYFDDETVVNHQRLL-DYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLFF 278
            :.:|||......|..|.:| .||..|::::|....:.|::|....:|........|.|..::|| 
  Fly   216 VSKLGYGAPLPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLF- 279

  Fly   279 VGDT-----ISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLI 338
             |:.     :::::.||   ::..:....||.|....:|.|.|..|::|..|..||.:.|..||:
  Fly   280 -GNVGIMRFMNMLFLLV---ILTTETLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLL 340

  Fly   339 F---TQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVV 378
            .   .|:.:     |:.:|.::.:::..|...:|.||::..::
  Fly   341 MLARCQIPM-----ILVSGVIVPISMKTFTVMIKGAYTMLTLL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 70/337 (21%)
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 70/337 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468594
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29KC3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26189
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 1 1.000 - - FOG0008557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.