DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33c and LOC1280680

DIOPT Version :10

Sequence 1:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_320541.1 Gene:LOC1280680 / 1280680 VectorBaseID:AGAMI1_012949 Length:419 Species:Anopheles gambiae


Alignment Length:88 Identity:20/88 - (22%)
Similarity:31/88 - (35%) Gaps:18/88 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SDGGEAKLLFFPEGTRGNGDKLLPLKKGCFHVAVESQAFIQPVVISKYHFLKSKAKIFKRGQNII 67
            ||.||.     .|....|||..||    .|.|.:     |....|:..|:...:.:..::..|.:
Mosquito   534 SDAGET-----DEMKEENGDDDLP----WFDVGI-----IDKATINVTHYFNDRQQSLEKQLNDL 584

  Fly    68 KILPEVSCAG----LSKDDIPAL 86
            .......|..    .::|.||.:
Mosquito   585 IDHNAFKCVNDSVFTTEDKIPLI 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 5/31 (16%)
LOC1280680XP_320541.1 7tm_6 <231..408 CDD:251636
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.