DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33b and Or19a

DIOPT Version :9

Sequence 1:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:405 Identity:101/405 - (24%)
Similarity:171/405 - (42%) Gaps:70/405 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RVIRSEDIY----RTYW--------LYWHLLGLESNFFLNRLLDLVITIFVTIWYPIHLILGLFM 58
            |:.|...|:    ||:|        :.|:                 :|..:.||  :...:.|..
  Fly    17 RIFRIMGIHPPGKRTFWGRHYTAYSMVWN-----------------VTFHICIW--VSFSVNLLQ 62

  Fly    59 ERSLGDVCKGLPITAACFFASFKFICFRFKLSEIKEIEILFKELDQRALSREECEFFNQNTRREA 123
            ..||...|:.|.:|........|.|..|....::.....|.:.||:|....:|.:.......| |
  Fly    63 SNSLETFCESLCVTMPHTLYMLKLINVRRMRGQMISSHWLLRLLDKRLGCDDERQIIMAGIER-A 126

  Fly   124 NFIWKSFI------VAYGLSNISAIASVLFGGGHKLLYPAWFPYDVQ-------ATELIFWLSVT 175
            .||:::..      |..|:..|||.:.      ..|:||.|.|::.:       ||.:   |..|
  Fly   127 EFIFRTIFRGLACTVVLGIIYISASSE------PTLMYPTWIPWNWRDSTSAYLATAM---LHTT 182

  Fly   176 YQIAGVSLAILQNLANDSYPPMTFCVVAGHVRLLAMRLSRIGQGPEETIYLTGKQLIESIEDHRK 240
            ..:|..:|.:  ||:  |||.....:|:.|.:.||:|:|::|.|...........|:..|.||:.
  Fly   183 ALMANATLVL--NLS--SYPGTYLILVSVHTKALALRVSKLGYGAPLPAVRMQAILVGYIHDHQI 243

  Fly   241 LMKIVELLRSTMNISQLGQFISSGVNISITLVNILFFADNNFAITYYGVYFLSMVL--ELFPCCY 303
            ::::.:.|..:::::...||.|:.. ...|:...|.|. |...:.:..:.||.::|  |....||
  Fly   244 ILRLFKSLERSLSMTCFLQFFSTAC-AQCTICYFLLFG-NVGIMRFMNMLFLLVILTTETLLLCY 306

  Fly   304 YGTLISVEMNQLTYAIYSSNWMSMNRSYSRILLIFMQLTLAEVQIK----AGGMIGIGMNAFFAT 364
            ...|...|...|..|:||.||:|.:.::.|:||    |.||..||.    :|.::.|.|..|...
  Fly   307 TAELPCKEGESLLTAVYSCNWLSQSVNFRRLLL----LMLARCQIPMILVSGVIVPISMKTFTVM 367

  Fly   365 VRLAYSFFTLAMSLR 379
            ::.||:..||...:|
  Fly   368 IKGAYTMLTLLNEIR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 85/326 (26%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 85/326 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468595
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29KC3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.