DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33b and Or98a

DIOPT Version :9

Sequence 1:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:403 Identity:95/403 - (23%)
Similarity:179/403 - (44%) Gaps:50/403 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KP---RVIRSEDIYRTYWLY------WHLLGLESNFFLNRLLDLVITIFVTIWYPIHLILGLFME 59
            ||   .::.|.|.:| |:.|      ||...      .::::..:.:..:..|..::|.:|:.:.
  Fly     8 KPNPTNLLTSPDSFR-YFEYGMFCMGWHTPA------THKIIYYITSCLIFAWCAVYLPIGIIIS 65

  Fly    60 RSLGDVCKGLP----ITAACFFAS----FKFICFRFKLSEIKEIEILFKELDQRALSREECEFFN 116
            ... |:....|    .....||.|    ||.:.|...:|...:.:.|..|:|:|..:.:|....:
  Fly    66 FKT-DINTFTPNELLTVMQLFFNSVGMPFKVLFFNLYISGFYKAKKLLSEMDKRCTTLKERVEVH 129

  Fly   117 QNTRR--EANFIWKSFIVAYGLSNISAIASVLFGGGHKLLYPAWFPY-DVQATELIFWLSVTYQI 178
            |...|  :|..|::....||   .||...|....|  ||.:..:.|: |.:.:...||.:...:.
  Fly   130 QGVVRCNKAYLIYQFIYTAY---TISTFLSAALSG--KLPWRIYNPFVDFRESRSSFWKAALNET 189

  Fly   179 AGVSLAILQNLANDSYPPMTFCVVAGHVRLLAMRLSRI----GQGPEETIYLTGKQLIESIEDHR 239
            |.:..|:.|.|.:|.||.:...::..|::||.:|:..:    |:...|    ..:.||:.|:||.
  Fly   190 ALMLFAVTQTLMSDIYPLLYGLILRVHLKLLRLRVESLCTDSGKSDAE----NEQDLIKCIKDHN 250

  Fly   240 KLMKIVELLRSTMNISQLGQFISSGVNISITLVNILFFADNNFAITYYGV----YFLSMVLELFP 300
            .::.....:|..:..:...||:..|:.:.::::|:|||||     .:.|:    |...::::.||
  Fly   251 LIIDYAAAIRPAVTRTIFVQFLLIGICLGLSMINLLFFAD-----IWTGLATVAYINGLMVQTFP 310

  Fly   301 CCYYGTLISVEMNQLTYAIYSSNWMSMNRSYSRILLIFMQLTLAEVQIKAGGMIGIGMNAFFATV 365
            .|:...|:..:...|..||:.|||::.:|||...|..|::.....:...||.:..|...:.....
  Fly   311 FCFVCDLLKKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVA 375

  Fly   366 RLAYSFFTLAMSL 378
            :||:|..|....|
  Fly   376 KLAFSVVTFVNQL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 79/326 (24%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 78/318 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.