DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33b and Or85f

DIOPT Version :9

Sequence 1:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster


Alignment Length:426 Identity:84/426 - (19%)
Similarity:156/426 - (36%) Gaps:134/426 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LVITIFVTIWYPIHLILGLFMERSLGDVCKGLPITAA--CFFASFKFICFR----------FKLS 90
            |..|:|   |     |:|..|        .|:|.|.:  ..:..::|:|..          |::.
  Fly    14 LPTTVF---W-----IMGYDM--------LGVPKTRSRRILYWIYRFLCLASHGVCVGVMVFRMV 62

  Fly    91 EIKEIEIL-------------------FKELDQR----ALSREECEFFNQNT-----RREANFIW 127
            |.|.|:.:                   |..:.||    :|:.:..|.:.:.|     .|..:..|
  Fly    63 EAKTIDNVSLIMRYATLVTYIINSDTKFATVLQRSAIQSLNSKLAELYPKTTLDRIYHRVNDHYW 127

  Fly   128 -KSF---IVAYGLSNISA-----IASVLFGGGHKL----------LY-----PAWFPYDVQATEL 168
             |||   ::.|..|:|..     |.|::....|.:          ||     |.|....:.|.| 
  Fly   128 TKSFVYLVIIYIGSSIMVVIGPIITSIIAYFTHNVFTYMHCYPYFLYDPEKDPVWIYISIYALE- 191

  Fly   169 IFWLSVTYQIAGVSLAILQNLANDSYPPMTFCVVAGHVRLLAMRLSRIGQGPEETIYLTGKQLIE 233
              ||..|..       ::.|:..|             :.||..::.         |.|..:.:|.
  Fly   192 --WLHSTQM-------VISNIGAD-------------IWLLYFQVQ---------INLHFRGIIR 225

  Fly   234 SIEDHRK-----------LMKIVE------LLRSTMN----ISQLGQFISSGVNISITLVNILFF 277
            |:.||:.           :.|||:      .|::.:|    .|.|...:::...|....|..|..
  Fly   226 SLADHKPSVKHDQEDRKFIAKIVDKQVHLVSLQNDLNGIFGKSLLLSLLTTAAVICTVAVYTLIQ 290

  Fly   278 ADNNFAITYYGVYFLSMVLELFPCCYYGTLISVEMNQLTYAIYSSNWMSMNRSYSRILLIFMQLT 342
            .......||. ::..:.|::::..||||..:.....::.:|:|:.::...:.:|.|.|||.:...
  Fly   291 GPTLEGFTYV-IFIGTSVMQVYLVCYYGQQVLDLSGEVAHAVYNHDFHDASIAYKRYLLIIIIRA 354

  Fly   343 LAEVQIKAGGMIGIGMNAFFATVRLAYSFFTLAMSL 378
            ...|::.|.|.:.|.::.|...:.::|...|:.|.:
  Fly   355 QQPVELNAMGYLSISLDTFKQLMSVSYRVITMLMQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 74/392 (19%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 65/345 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465838
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.