DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33b and Or85e

DIOPT Version :9

Sequence 1:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster


Alignment Length:415 Identity:85/415 - (20%)
Similarity:145/415 - (34%) Gaps:105/415 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VTIWYPIHLILGLFMERSLGDV---------CKGLPITAACFFASFKFI--CFRFKLSEIKEIEI 97
            :.|:..:|  ||:...::..||         ...|.:|...||..:..|  |.|.: ..:..:|.
  Fly    69 MVIFTSLH--LGVLFTKTTLDVLPTGELQAITDALTMTIIYFFTGYGTIYWCLRSR-RLLAYMEH 130

  Fly    98 LFKELDQRALSREECEFFNQNTRREANF--IWKSFIVAYGLSNISAIASVLFGGGHKLLYPAWFP 160
            :.:|....:|:.......:...|...||  :|   |::..|..||...|.|..|...|....|:|
  Fly   131 MNREYRHHSLAGVTFVSSHAAFRMSRNFTVVW---IMSCLLGVISWGVSPLMLGIRMLPLQCWYP 192

  Fly   161 YD---------VQATELI--FWLSVTYQIAGVSLAILQNLANDSYPPMTFCVVA---GHVRLLA- 210
            :|         |.||:|.  ..:.:|:...| ||.:..:|.......:.:|.:.   .|.:||. 
  Fly   193 FDALGPGTYTAVYATQLFGQIMVGMTFGFGG-SLFVTLSLLLLGQFDVLYCSLKNLDAHTKLLGG 256

  Fly   211 -----------------------------------MRLSRIGQGPEETIYLTG----KQLIESIE 236
                                               :|||...:.|::     |    ..|:|.|.
  Fly   257 ESVNGLSSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQ-----GNAFHNALVECIR 316

  Fly   237 DHRKLMK-------------IVELLRSTMNISQLGQFISSGVNISITLVNILFFADNNFAITYYG 288
            .||.::.             :|:.|:.|..:..|.....||....:.:||         .:.|.|
  Fly   317 LHRFILHCSQELENLFSPYCLVKSLQITFQLCLLVFVGVSGTREVLRIVN---------QLQYLG 372

  Fly   289 VYFLSMVLELFPCCYYGTLISVEMNQLTYAIYSSNWMSMNRSYSRILLIFMQLTLAEVQIKAGGM 353
            :    .:.||....|.|.|:|....:...|.:...|........:.:|||:..:...|.:.||..
  Fly   373 L----TIFELLMFTYCGELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKF 433

  Fly   354 IGIGMNAFFATVRLAYSFFTLAMSL 378
            ..:.:|...:.:..|:||.||...|
  Fly   434 YVMDVNRLRSVITQAFSFLTLLQKL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 75/387 (19%)
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 67/351 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.