DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33b and Or83a

DIOPT Version :9

Sequence 1:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:427 Identity:78/427 - (18%)
Similarity:153/427 - (35%) Gaps:103/427 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YWLYWHLLGL------------ESNFFLNRLLDLVITIFVTIWYPIHLILGLFMERSLGDVCKGL 69
            |::..|:.||            :.:||:|.|:..:|.::.                         
  Fly    61 YFVSVHIAGLYICTIYINYGQGDLDFFVNCLIQTIIYLWT------------------------- 100

  Fly    70 PITAACFFASFKFICFRFKLSEIKEIEILFKELDQRALSREECEFFNQNTRREANFIW-KSFIVA 133
             |....:|..|:.......||.|.:      |.:.|  |.....|.........:.:| |:::..
  Fly   101 -IAMKLYFRRFRPGLLNTILSNIND------EYETR--SAVGFSFVTMAGSYRMSKLWIKTYVYC 156

  Fly   134 YGLSNISAIASVLFGGGHKLLYPAWFPYDVQ---ATELIFWLSVTYQI---------AGVSLAIL 186
            ..:..|..:|..:......|....|:|:|..   ..|::|.|....||         :|:.: :|
  Fly   157 CYIGTIFWLALPIAYRDRSLPLACWYPFDYTQPGVYEVVFLLQAMGQIQVAASFASSSGLHM-VL 220

  Fly   187 QNLANDSYPPMTFC----VVAGHVRLLAMRLSRIGQ----------------------GPEETIY 225
            ..|.:..| .:.||    |:|....|:...::.:.|                      .|.:.:.
  Fly   221 CVLISGQY-DVLFCSLKNVLASSYVLMGANMTELNQLQAEQSAADVEPGQYAYSVEEETPLQELL 284

  Fly   226 LTGKQL----------IESIEDHRKL---MKIVELLRSTMNISQLGQFISSGVNISITLVNILFF 277
            ..|..:          :..|:.||.:   :|.:|...|.:...::|:.  :.:...:..|:....
  Fly   285 KVGSSMDFSSAFRLSFVRCIQHHRYIVAALKKIESFYSPIWFVKIGEV--TFLMCLVAFVSTKST 347

  Fly   278 ADNNF-AITYYGVYFLSMVLELFPCCYYGTLISVEMNQLTYAIYSSNWMSMNRSYSRILLIFMQL 341
            |.|:| .:...|.|.|.::.|||..||:..::.....:...|::.|.|....:......:.||..
  Fly   348 AANSFMRMVSLGQYLLLVLYELFIICYFADIVFQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLN 412

  Fly   342 TLAEVQIKAGGMIGIGMNAFFATVRLAYSFFTLAMSL 378
            :..:.|:.||.:..:.::.|..|:..|:||.||...:
  Fly   413 SRRQFQLTAGKISNLNVDRFRGTITTAFSFLTLLQKM 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 64/360 (18%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 52/288 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.