DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33b and Or56a

DIOPT Version :9

Sequence 1:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:426 Identity:85/426 - (19%)
Similarity:160/426 - (37%) Gaps:85/426 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EDIYRTYWLYWHLLGLESNFFLNR-LLDLVITIFVT--IWYPIHLILGLFME--RSLGDVCKGLP 70
            :.|:.|:..|:...|..::...|| ||.|:....:|  ||....|:|.....  .:|.|..... 
  Fly    16 DPIFGTHLRYFQWYGYVASKDQNRPLLSLIRCTILTASIWLSCALMLARVFRGYENLNDGATSY- 79

  Fly    71 ITAACFF----ASFKFICFRFKLSEI-----KEIEILFKELDQRALSREECEFF---NQNTRREA 123
            .||..:|    |.|.....|.|:..:     .:|:.|..|.|.|     |.|..   ...||...
  Fly    80 ATAVQYFAVSIAMFNAYVQRDKVISLLRVAHSDIQNLMHEADNR-----EMELLVATQAYTRTIT 139

  Fly   124 NFIWKSFIVAYGL--------------SNISAIASVLFGGGHKLLYPAWFPYDVQATELIFWLSV 174
            ..||...::| ||              .::..:.:|..|..|.:|....||:.......:.....
  Fly   140 LLIWIPSVIA-GLMAYSDCIYRSLFLPKSVFNVPAVRRGEEHPILLFQLFPFGELCDNFVVGYLG 203

  Fly   175 TYQIAGVSLAILQNLANDSYPPMTFCVVAGHVRLLAMRLSRIGQGPEETIY-----------LTG 228
            .:...|:.:..:         |:....:...::.:.::|..:.:..||...           ||.
  Fly   204 PWYALGLGITAI---------PLWHTFITCLMKYVNLKLQILNKRVEEMDITRLNSKLVIGRLTA 259

  Fly   229 KQLI--------ESIEDHRKLMKIVELLRSTMNISQLGQFISSGVNISITLVNILFFA------- 278
            .:|.        |.:::..::.|.|:.|:..:.:..:..||     |...|:..||||       
  Fly   260 SELTFWQMQLFKEFVKEQLRIRKFVQELQYLICVPVMADFI-----IFSVLICFLFFALTVGVPS 319

  Fly   279 --DNNFAITYYGVYFLSMVLELFPCCYYGTLISVEMNQLTYAIYSSNWMSMNRSYSRILLIFMQL 341
              |..|...|  ::.::.:|.::.  ::.|||....::|:.|.:|..|.:......::|:..|..
  Fly   320 KMDYFFMFIY--LFVMAGILWIYH--WHATLIVECHDELSLAYFSCGWYNFEMPLQKMLVFMMMH 380

  Fly   342 TLAEVQIKAGGMIGIGMNAFFATVRLAYSFFTLAMS 377
            ....::::| .::.:.:..|....|.|||:|.|..|
  Fly   381 AQRPMKMRA-LLVDLNLRTFIDIGRGAYSYFNLLRS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 65/361 (18%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 50/300 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.