DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33b and Or49a

DIOPT Version :9

Sequence 1:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:414 Identity:81/414 - (19%)
Similarity:145/414 - (35%) Gaps:99/414 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DIYRTYWLYWHLLGLESNFFLNRLLDL----VITIFVTIWYPIHLILGLFMERSLGDVCK----G 68
            |::.|...:|..|.:...|.|..:.:.    ::|..:..|           |...|...|    |
  Fly    24 DLFHTPKPWWRYLLVRGYFVLCTISNFYEASMVTTRIIEW-----------ESLAGSPSKIMRQG 77

  Fly    69 LPITAACFF----ASFKFICFRFKLSEIKEIEILFKEL----DQRALSREECEFFNQNTRREANF 125
            |.     ||    :..|||.|......:.::....|||    :|.....|..:::...:.|...:
  Fly    78 LH-----FFYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRKYEVNKYYLSCSTRNVLY 137

  Fly   126 IWKSFIVAYGLSN-ISAIASVLFGGG-----HKLLYPAWFPYDVQ---ATELIFWLSVTYQ--IA 179
            ::...:|...|.. :.:....|.|.|     :|.::|....:|.:   ...|.:.:..||.  |.
  Fly   138 VYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPLGYVLAYVIDFTYSQFIV 202

  Fly   180 GVSLAILQNLANDSYPPMTFCVVAGHVRLLAMRLSRIGQGPEETIYLTGKQ----LIESIEDHRK 240
            .||      |..|.:.......::.|:..||..|:.|...||     |.:|    |...|:.|:.
  Fly   203 NVS------LGTDLWMMCVSSQISMHLGYLANMLASIRPSPE-----TEQQDCDFLASIIKRHQL 256

  Fly   241 LMKIVELLRSTMNISQLGQFISSGVNISITLVNILFFADNNF-------AITYYGV--------- 289
            ::::.:                     .:..|..|..|.|.|       .:.||.|         
  Fly   257 MIRLQK---------------------DVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGI 300

  Fly   290 ----YFLSMVLELFPCCYYGTLISVEMNQLTYAIYSSNWMSMNRSYSRILLIFMQLTLAEVQIKA 350
                .|.|:..:.:....:|.::......|..|.:.|.|...:..|.:.:||.|......::|.|
  Fly   301 SYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISA 365

  Fly   351 GGMIGIGMNAFFATVRLAYSFFTL 374
            .|:|.|.::.|...:.:.|.||.:
  Fly   366 RGVIIISLDTFKILMTITYRFFAV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 69/354 (19%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 63/327 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.