DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33b and Or42b

DIOPT Version :9

Sequence 1:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:357 Identity:89/357 - (24%)
Similarity:171/357 - (47%) Gaps:20/357 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RLLDLVITIFVTIWYPIHL---ILGLFMER----SLGDVCKGLPITAACFFASFKFICFRFKLSE 91
            |.:.|..|:...:|...:|   .||.:|.:    |.|:....|.:....:.:|.|.......|..
  Fly    42 RYVYLTWTLMTFVWCTTYLPLGFLGSYMTQIKSFSPGEFLTSLQVCINAYGSSVKVAITYSMLWR 106

  Fly    92 IKEIEILFKELDQRALSREECEFFNQNTRREANFIWKSFIVAY-GLSNISAIASVLFGGGHKLLY 155
            :.:.:.:..:||.|..:.||.|..:....| :|..:..|...| |.:..:.::|||.|      .
  Fly   107 LIKAKNILDQLDLRCTAMEEREKIHLVVAR-SNHAFLIFTFVYCGYAGSTYLSSVLSG------R 164

  Fly   156 PAWFPY----DVQATELIFWLSVTYQIAGVSLAILQNLANDSYPPMTFCVVAGHVRLLAMRLSRI 216
            |.|..|    |.....|..|::.|.:...:|.|:||:..:||||.:...::..|:.:|..|:.|:
  Fly   165 PPWQLYNPFIDWHDGTLKLWVASTLEYMVMSGAVLQDQLSDSYPLIYTLILRAHLDMLRERIRRL 229

  Fly   217 GQGPEETIYLTGKQLIESIEDHRKLMKIVELLRSTMNISQLGQFISSGVNISITLVNILFFADNN 281
            ......:...:.::|::.:.||:.:::...:::..:..:...||:..|:.:..||:|:.||:|..
  Fly   230 RSDENLSEAESYEELVKCVMDHKLILRYCAIIKPVIQGTIFTQFLLIGLVLGFTLINVFFFSDIW 294

  Fly   282 FAITYYGVYFLSMVLELFPCCYYGTLISVEMNQLTYAIYSSNWMSMNRSYSRILLIFMQLTLAEV 346
            ..|..: ::.::::|:.||.||...||..:...||:||:.|||:..:|.|...||.|:|.....:
  Fly   295 TGIASF-MFVITILLQTFPFCYTCNLIMEDCESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPI 358

  Fly   347 QIKAGGMIGIGMNAFFATVRLAYSFFTLAMSL 378
            ...|||:..|.|::..:..:.|:|..|:...:
  Fly   359 VFIAGGIFQISMSSNISVAKFAFSVITITKQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 78/312 (25%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 78/312 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468619
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 1 1.000 - - otm50671
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.