DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33b and Or24a

DIOPT Version :9

Sequence 1:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:408 Identity:79/408 - (19%)
Similarity:145/408 - (35%) Gaps:114/408 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NFFLNRLLDLVITIFVTIWYPIHLILGLFMERSLGDVCKGLPITAACFFASFKFICFRFKLSEIK 93
            |||:     |....:...:|.||.| .:.:..:|..:|   |:.::.             ||.:|
  Fly    46 NFFI-----LTYGCYAEAYYGIHYI-PINIATALDALC---PVASSI-------------LSLVK 88

  Fly    94 EIEILFKELDQRALSREECEFFNQNTRREANFIWKSFIVAYGLSNISAIASVLFGGGHKLLYPAW 158
            .:.|.:.:.:.|:|. |...|..:..:.:                            .||.|...
  Fly    89 MVAIWWYQDELRSLI-ERVRFLTEQQKSK----------------------------RKLGYKKR 124

  Fly   159 FPYDVQATELIFWL-------SVTYQIAGVSLAILQNLANDS----------YP---------PM 197
            | |.: ||:|.|.|       |.:|.:..:...||:......          :|         |:
  Fly   125 F-YTL-ATQLTFLLLCCGFCTSTSYSVRHLIDNILRRTHGKDWIYETPFKMMFPDLLLRLPLYPI 187

  Fly   198 TFCVVAGH-----------------------VRLLAMR--------LSRIGQGPEETIYLTGKQL 231
            |:.:|..|                       |.||.::        :..|.:.|.|.......:.
  Fly   188 TYILVHWHGYITVVCFVGADGFFLGFCLYFTVLLLCLQDDVCDLLEVENIEKSPSEAEEARIVRE 252

  Fly   232 IESIED-HRKLMKIVELLRSTMNISQLGQFISSGVNISITLVNILFFADNNFAITYYGVYFLSMV 295
            :|.:.| |.::.::.|.|...|....|..|::|.:.|..::|:||.|  :...|..|.||..::.
  Fly   253 MEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSLIIGTSVVDILLF--SGLGIIVYVVYTCAVG 315

  Fly   296 LELFPCCYYGTLISVEMNQLTYAIYSSNWMSMNRSYSRILLIFMQLTLAEVQIKAGGMIGIGMNA 360
            :|:|..|..|:.|....:.|..:.:||:|...:....::.|:.:......:.||. ......:..
  Fly   316 VEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVRVQKMTLLMVARAQRVLTIKI-PFFSPSLET 379

  Fly   361 FFATVRLAYSFFTLAMSL 378
            ..:.:|...|...||.|:
  Fly   380 LTSILRFTGSLIALAKSV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 67/365 (18%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 67/369 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.