DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33b and Or22b

DIOPT Version :9

Sequence 1:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:386 Identity:95/386 - (24%)
Similarity:176/386 - (45%) Gaps:36/386 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRSEDIY----RTYWLY---------WHLLGLESNFFLNRLLDLVITIFVTIWYPIHLILGLFME 59
            ::|.|.:    |..|.:         |.|.....:.|:..|:.:::.|.|::.|     :..|..
  Fly    18 VKSRDAFVYLDRVMWSFGWTVPENKRWDLHYKLWSTFVTLLIFILLPISVSVEY-----IQRFKT 77

  Fly    60 RSLGDVCKGLPITAACFFASFKFICFRFKLSEIKEIEILFKELDQRALSREECEFFNQNTRREAN 124
            .|.|:....:.|....:.:|||.........:.:|.::...|||:|.:..||....:::... .|
  Fly    78 FSAGEFLSSIQIGVNMYGSSFKSYLTMMGYKKRQEAKMSLDELDKRCVCDEERTIVHRHVAL-GN 141

  Fly   125 FIWKSFIVAYGLSNISAIASVLFGGGHKLLYPAW---FPYDVQATELIFWLSVTYQIAGVSLAIL 186
            |.:..:.:||....||...|.:....|     ||   |||  ...|..|::|...::.....|:.
  Fly   142 FCYIFYHIAYTSFLISNFLSFIMKRIH-----AWRMYFPY--VDPEKQFYISSIAEVILRGWAVF 199

  Fly   187 QNLANDSYPPMTFCVVAGHVRLLAMRLSRIGQGP--EETIYLTGKQLIESIEDHRKLMKIVELLR 249
            .:|..|..|.::..:...|:.||..||..:...|  .|..||  |:|.:.:.|||.::..|:.||
  Fly   200 MDLCTDVCPLISMVIARCHITLLKQRLRNLRSEPGRTEDEYL--KELADCVRDHRLILDYVDALR 262

  Fly   250 STMNISQLGQFISSGVNISITLVNILFFADNNFAITYYGVYFLSMV-LELFPCCYYGTLISVEMN 313
            |..:.:...||:..|:.:.::::||:||:..:..:..  |.|:|.| ::.||.||...:|..:..
  Fly   263 SVFSGTIFVQFLLIGIVLGLSMINIMFFSTLSTGVAV--VLFMSCVSMQTFPFCYLCNMIMDDCQ 325

  Fly   314 QLTYAIYSSNWMSMNRSYSRILLIFMQLTLAEVQIKAGGMIGIGMNAFFATVRLAYSFFTL 374
            ::..:::.|:|.|.:|.|...|:.|:......:.:.|||:..|.|......|:||::..|:
  Fly   326 EMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVFPISMQTNLNMVKLAFTVVTI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 81/313 (26%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 80/311 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468617
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 1 1.000 - - otm50671
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.