DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33b and Or82a

DIOPT Version :9

Sequence 1:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:343 Identity:77/343 - (22%)
Similarity:147/343 - (42%) Gaps:59/343 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 ACFFASF-------KFICFRFKLSEIKEIEILFKELDQRALS-----REECEFFNQNTRREANFI 126
            ||....|       |...|.....:..|:...|:::.:::.|     ||..::..: ..:.|:|:
  Fly    63 ACLSVVFTNMLTVIKISTFLANRKDFWEMIHRFRKMHEQSASHIPRYREGLDYVAE-ANKLASFL 126

  Fly   127 WKSFIVAYGLSNISAIASVLFGGG----------HKLLYPAWFPY-DVQA---------TELIFW 171
            .:::.|:.||:.:..:...:...|          .:|..|..||: |:::         |.|:..
  Fly   127 GRAYCVSCGLTGLYFMLGPIVKIGVCRWHGTTCDKELPMPMKFPFNDLESPGYEVCFLYTVLVTV 191

  Fly   172 LSVTYQIA--GVSLAILQNLANDSYPPMTFCVVAGHVRLLAMRLSR---IGQGPEETIYLTGKQL 231
            :.|.|..|  |:.::...||             ..|.:.|..::..   ....|:..|.|  |.:
  Fly   192 VVVAYASAVDGLFISFAINL-------------RAHFQTLQRQIENWEFPSSEPDTQIRL--KSI 241

  Fly   232 IESIEDHRKLMKIVELLRSTMNISQLGQFISSGVNISITLVNILFFADNNFAITYYGVYFLSMVL 296
            :|.   |..|:.:...|||....:.:|||:.:.:.:.:.:..::...|:...:..|..:|.|::|
  Fly   242 VEY---HVLLLSLSRKLRSIYTPTVMGQFVITSLQVGVIIYQLVTNMDSVMDLLLYASFFGSIML 303

  Fly   297 ELFPCCYYGTLISVEMNQLTYAIYSSNW-MSMNRSYSRILLIFMQLTLAEVQIKAGGMIGIGMNA 360
            :||..||.|.:|..|..|:..|:..||| ::..::.:.:.||.:| :..||.|:||..:....| 
  Fly   304 QLFIYCYGGEIIKAESLQVDTAVRLSNWHLASPKTRTSLSLIILQ-SQKEVLIRAGFFVASLAN- 366

  Fly   361 FFATVRLAYSFFTLAMSL 378
            |....|.|.|..||..|:
  Fly   367 FVGICRTALSLITLIKSI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 72/332 (22%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 70/329 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.