DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33b and Or65c

DIOPT Version :9

Sequence 1:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster


Alignment Length:389 Identity:79/389 - (20%)
Similarity:150/389 - (38%) Gaps:105/389 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLKPRVIRSEDIYRTYWLYWHLLGLESNF-------------FL---------------NRLLD 37
            ||::..|.|....|...|.::....:||::             ||               :.|:.
  Fly     1 MDIRGNVHRFVKFYIDGWKHFRDPTMESSYSAVYYWREQMKAMFLYTTSKERQMPYRSSWHTLVI 65

  Fly    38 LVITI-FVTIWYPIHLILGLFMERSLGD---VCKGLPITAACFFASFKFICFRF---KLSEIKEI 95
            :..|: |:|:.|.:        ..||||   :.:.:......|:.:||...|::   :|.|:.|.
  Fly    66 IQATVCFLTMCYGV--------TESLGDKVQMGRDIAFIIGFFYIAFKIYYFQWYGDELDEVVEA 122

  Fly    96 EILFK--------ELDQRALSREECEFFNQNTRREANFIWKSFIVAYGLSNISAIASVLFGGGHK 152
            ...|.        .:|.|...|   .:|..     |.|:..|::|...:..:..|.|.|:  .|:
  Fly   123 LETFHPWAQKGPGAVDYRTAKR---WYFTL-----AFFLASSWLVFLCIFILLLITSPLW--VHQ 177

  Fly   153 LLYP--AWFP----------------YDVQATELIFWLSVTYQIAGVSLAILQNLANDSYPPMTF 199
            .:.|  |.||                |..|...::::|:....|.|:|::|        |..:||
  Fly   178 QILPLHAAFPFQWHEKSIHPISHAFIYLFQTWNVMYFLTWLVCIEGLSVSI--------YVEITF 234

  Fly   200 CVVAGHVRLLAMRLSRIGQ---GPEETIYLTGKQLIESIEDHRKLMKIVELLRSTMNISQLGQFI 261
            .     :.:|.:.|..:.|   |.|: :.|...:|::.   |:   |||.:|..|..:......:
  Fly   235 A-----IEVLCLELRHLHQRCHGYEQ-LRLETNRLVQF---HQ---KIVHILDHTNKVFHGTLIM 287

  Fly   262 SSGVN---ISITLVNILFFADNNFAITYYGVYFLSMVLELFPCCYYGTLISVEMNQLTYAIYSS 322
            ..|||   :|::::..:....:...:..:.|..|..:..|....|:|.|:|.:...::.|.|.:
  Fly   288 QMGVNFFLVSLSVLEAMEARKDPKVVAQFAVLMLLALGHLSMWSYFGDLLSQKSLTISEAAYEA 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 64/300 (21%)
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 60/295 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465205
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.