DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33b and Or2a

DIOPT Version :9

Sequence 1:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:387 Identity:110/387 - (28%)
Similarity:185/387 - (47%) Gaps:37/387 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YWLYWHLLGLESNFFLNRLL----DLVITIFVTIWYPIHLILGLFMERSLGDVCKGLPITAACFF 77
            :|..|.|.||.....::.||    .:.:.:.||:.:|:.|:..|....::..:|:.|.||.....
  Fly    18 HWRVWELTGLMRPPGVSSLLYVVYSITVNLVVTVLFPLSLLARLLFTTNMAGLCENLTITITDIV 82

  Fly    78 ASFKFICFRFKLSEIKEIEILFKELDQRALSREECEFFNQNTRREANFIWKSF-----IVAYGLS 137
            |:.||........::.||..|.:.:|.||....:.|..:. .|:|.|....:|     |..:| :
  Fly    83 ANLKFANVYMVRKQLHEIRSLLRLMDARARLVGDPEEISA-LRKEVNIAQGTFRTFASIFVFG-T 145

  Fly   138 NISAIASVLFGGGHKLLYPAWFPYDVQATELIFWLSVTYQIAGVSLAILQNLANDSYPPMTFCVV 202
            .:|.: .|:.....:|||||||..|...:...:.|...||:.|:.:..:||.|:|||||...|::
  Fly   146 TLSCV-RVVVRPDRELLYPAWFGVDWMHSTRNYVLINIYQLFGLIVQAIQNCASDSYPPAFLCLL 209

  Fly   203 AGHVRLLAMRLSRIGQGPE------------ETIYLTGKQLIESIEDHRKLMKIVELLRSTMNIS 255
            .||:|.|.:|:.|||...|            |.:|   ::|||.|.|..::.::.|:::..:::.
  Fly   210 TGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVY---QELIECIRDLARVHRLREIIQRVLSVP 271

  Fly   256 QLGQFISSGVNISITLVNILFFAD--NNFAITYYGVYFLSMVLELFPCCYYGTLISVEMNQLTYA 318
            .:.||:.|........::.|:.||  ::.|:....|:|.::.||:|..||:|..:..:...|..|
  Fly   272 CMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDA 336

  Fly   319 IYSSNWMSMNRSYSRILLIFMQLTLAEVQ----IKAGGMIGIGMNAFFATVRLAYSFFTLAM 376
            .|..||:.....:.|.||    .|||..|    |.||..|.:.:..|...:|..||.|||.:
  Fly   337 FYDCNWIEQLPKFKRELL----FTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLLL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 93/330 (28%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 93/330 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I7421
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27053
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9588
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2678
88.010

Return to query results.
Submit another query.