DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33a and Or98b

DIOPT Version :9

Sequence 1:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:400 Identity:90/400 - (22%)
Similarity:166/400 - (41%) Gaps:76/400 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WRLLGVE--------GDYPFRRL-VDFTITSFITILFPVHLILGMYKKPQI-QVFRSLHFTSECL 74
            :||||:|        ..||:|.: ...::.||:    |:.:..|:.....: |:..||......|
  Fly    14 FRLLGLELLHEQDVGHRYPWRSICCILSVASFM----PLTIAFGLQNVQNVEQLTDSLCSVLVDL 74

  Fly    75 FCSYKFFCFRWKLKEIKTIEG----LLQD------LDSRVESEEERNYFNQNPSRVARMLSKSYL 129
            ....|...|.|..|:.|.:.|    :||.      .:..|..|..|:.|      ::.|.:..::
  Fly    75 LALCKIGLFLWLYKDFKFLIGQFYCVLQTETHTAVAEMIVTRESRRDQF------ISAMYAYCFI 133

  Fly   130 VAAISAIITATVAGLFS---TGR---NLMYLGWFPYDFQATAAIYWISFSYQAIGSSLLILENLA 188
            .|.:||.:.:.::.|.|   ||.   ...:...:|:| ....:.|.||:.:....:..:.|..:.
  Fly   134 TAGLSACLMSPLSMLISYQRTGELQPKFPFPSVYPWD-NMKLSNYIISYFWNVCAALGVALPTVC 197

  Fly   189 NDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQDHRKLMKIIRLLRSTLHLS 253
            .|:    .||.:| |....:.:::|  |.:......||:      :.|..|..:.:|....|:|.
  Fly   198 VDT----LFCSLS-HNLCALFQIAR--HKMMHFEGRNTK------ETHENLKHVFQLYALCLNLG 249

  Fly   254 Q---------LGQFLSSGINISITL----INILFFAENNFAMLYYAVFFAAMLIELFPSCYYGIL 305
            .         :.||:::.:::.:..    .|||     ..|:|:||.|.||::.::...|:.|..
  Fly   250 HFLNEYFRPLICQFVAASLHLCVLCYQLSANIL-----QPALLFYAAFTAAVVGQVSIYCFCGSS 309

  Fly   306 MTMEFDKLPYAIFSSNW---LKMDKRYNRSL-IILMQLTL-VPVNIKAGGIVGIDMSAFFATVRM 365
            :..|......||:.|:|   |:.:.:...|| |.:|:.:| .|::   |.....:.......||.
  Fly   310 IHSECQLFGQAIYESSWPHLLQENLQLVSSLKIAMMRSSLGCPID---GYFFEANRETLITIVRT 371

  Fly   366 AYSFYTLALS 375
            |.|:.||..|
  Fly   372 AISYVTLLRS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 73/340 (21%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 73/340 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.