DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33a and Or94a

DIOPT Version :9

Sequence 1:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:383 Identity:78/383 - (20%)
Similarity:161/383 - (42%) Gaps:59/383 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WRLLG-VEGDYPFRRLVDFTITSFITILFPVHLILGMYKKPQIQVFRSL-------------HFT 70
            |...| |:.:|.|...:..|.| ||.:::....|....::....::.|:             |:.
  Fly    34 WTFTGFVKRNYRFLLHLPITFT-FIGLMWLEAFISSNLEQAGQVLYMSITEMALVVKILSIWHYR 97

  Fly    71 SECLFCSYKFFCFRWKLKEIKTIEGLLQDLDSRVESEEERNYFNQNPSRVARMLSKSYLVAAISA 135
            :|.           |:|     :..|....|.::.::||.:::.:. .|..:.....|::.::..
  Fly    98 TEA-----------WRL-----MYELQHAPDYQLHNQEEVDFWRRE-QRFFKWFFYIYILISLGV 145

  Fly   136 IITATVAGLFSTGRNLMYLGWFPYDFQATAAIYWISFSYQAIGSSLLILENLANDSYPPITFCVV 200
            :.:.....||..|..|.:..:.|:::| ....||.::.|...|.:|..:.|:..|:..    |..
  Fly   146 VYSGCTGVLFLEGYELPFAYYVPFEWQ-NERRYWFAYGYDMAGMTLTCISNITLDTLG----CYF 205

  Fly   201 SGHVRLLIMRLSRIGHDVKLSSSENTRK-LIEGIQDHRKLMKIIRLLRSTLHLSQLGQFLSSGIN 264
            ..|:.||...|.     ::|..::|.:. .|.| |..|.:..:.:.:||   |:...|.:.|...
  Fly   206 LFHISLLYRLLG-----LRLRETKNMKNDTIFG-QQLRAIFIMHQRIRS---LTLTCQRIVSPYI 261

  Fly   265 ISITLINILFFAENNFAMLYYAV------------FFAAMLIELFPSCYYGILMTMEFDKLPYAI 317
            :|..:::.|....:.:.:.:..:            |.:.|:::::..||||..:|:..::|...:
  Fly   262 LSQIILSALIICFSGYRLQHVGIRDNPGQFISMLQFVSVMILQIYLPCYYGNEITVYANQLTNEV 326

  Fly   318 FSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTLALS 375
            :.:|||:......:.|...|:....||.|:||....:.:..|..|:..||||..|.|:
  Fly   327 YHTNWLECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINNAYSFLALLLN 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 62/331 (19%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 62/337 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27053
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.