DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33a and Or88a

DIOPT Version :9

Sequence 1:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:405 Identity:80/405 - (19%)
Similarity:151/405 - (37%) Gaps:85/405 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WRLLGVEGDYPFRRLVDFTITSFITILF--------PVHLILG--MYKKPQIQVFRSLHFTSECL 74
            ||...|:.......:|.|.:::|:.:||        ..|..||  ..:.|.:        .|..:
  Fly    32 WRRNPVDNSMVNASMVPFCLSAFLNVLFFGCNGWDIIGHFWLGHPANQNPPV--------LSITI 88

  Fly    75 FCSYKFFCFRWKLKEI---------KTIEGLLQDLDSRVESEEERNYFNQNPSRVARMLSKSYLV 130
            :.|.:......|.|||         :....|:..||.::: |..||::.:  .|..|:.  |:|.
  Fly    89 YFSIRGLMLYLKRKEIVEFVNDLDRECPRDLVSQLDMQMD-ETYRNFWQR--YRFIRIY--SHLG 148

  Fly   131 AAISAIITATVAGLFSTGRNL-------MYLGWFPYDFQATAAIYWISFSYQAI----GSSLLI- 183
            ..:..::...:..|...|::.       :..||.|...:.....|.:.:|:..:    |.|..: 
  Fly   149 GPMFCVVPLALFLLTHEGKDTPVAQHEQLLGGWLPCGVRKDPNFYLLVWSFDLMCTTCGVSFFVT 213

  Fly   184 LENLANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQDHRKLMKIIRLLRS 248
            .:||.|         |:.||   |:|.|   ||..:..|:.:.|   :.:.|.::....:|||..
  Fly   214 FDNLFN---------VMQGH---LVMHL---GHLARQFSAIDPR---QSLTDEKRFFVDLRLLVQ 260

  Fly   249 TLHLSQ---------------LGQFLSSGINISITLINILFFAENNFAMLYYAVFFAAMLIEL-- 296
            ...|..               :..|:.:|     :|...||.......:|..|.:....|:.:  
  Fly   261 RQQLLNGLCRKYNDIFKVAFLVSNFVGAG-----SLCFYLFMLSETSDVLIIAQYILPTLVLVGF 320

  Fly   297 -FPSCYYGILMTMEFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFF 360
             |..|..|..:....:.|..::.|..|....:||.:..::..|.......:.|.|::.::|..|.
  Fly   321 TFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHFT 385

  Fly   361 ATVRMAYSFYTLALS 375
            ..:::||..:|...|
  Fly   386 EIMQLAYRLFTFLKS 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 64/344 (19%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 65/352 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465853
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.