DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33a and Or67b

DIOPT Version :9

Sequence 1:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:281 Identity:55/281 - (19%)
Similarity:105/281 - (37%) Gaps:65/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FRRLVDFTI----TSFITILFPV---HLILGMYKKPQIQVFRSLHFTSECLFCSYKFFCF----- 83
            |:.:.|..|    |..:|:.:|.   :|.||.|:.|. .|.|.....|..|:|.:..|.|     
  Fly   172 FQYIFDCYIKDKDTCEMTLTYPAIVPYLQLGNYEFPS-YVIRFFLLQSGPLWCFFAVFGFNSLFV 235

  Fly    84 ---RWKLKEIKTIEGLLQD--LDSRVESEEERNYFNQNPSRVARMLSK--------SYLV---AA 132
               |::...||.:..|:|:  .|..|..::...|........||:.|.        .|::   .:
  Fly   236 VLTRYESGLIKVLRFLVQNSTSDILVPKDQRVKYLQCCVRLFARISSHHNQIENLFKYIILVQCS 300

  Fly   133 ISAIITATVAGLFSTGRNLMYLGWFPYDFQATAAIYWISFSYQAIGSSLLILENLANDSYPPITF 197
            :|:|:...:....||   ::.:||.   :.....:|:::.:.:      :.|.|::...      
  Fly   301 VSSILICMLLYKIST---VLEVGWV---WMGMIMVYFVTIALE------ITLYNVSAQK------ 347

  Fly   198 CVVSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQDHRKLMKIIRLLRSTLHLSQLGQFLSSG 262
              |.....||.       ||....|..|..:      :.:.::|::.|......:..:|.|.|..
  Fly   348 --VESQSELLF-------HDWYNCSWYNESR------EFKFMIKMMLLFSRRTFVLSVGGFTSLS 397

  Fly   263 INISITLINILFFAENNFAML 283
            ...   |:.:...:.|.|.:|
  Fly   398 HKF---LVQVFRLSANFFLLL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 44/244 (18%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 46/247 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465188
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.