DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33a and Or56a

DIOPT Version :9

Sequence 1:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:241 Identity:50/241 - (20%)
Similarity:102/241 - (42%) Gaps:44/241 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 YLG-WFPYDFQATAAIYWISF---SYQAIGSSLLILENLANDSYPPITFCVVSGHVRLLIMRLSR 213
            ||| |:......||...|.:|   ..:.:...|.||..                  |:..|.::|
  Fly   201 YLGPWYALGLGITAIPLWHTFITCLMKYVNLKLQILNK------------------RVEEMDITR 247

  Fly   214 IGHDV---KLSSSENT----RKLIEGIQDHRKLMKIIRLLRSTLHLSQLGQFLSSGINISITLIN 271
            :...:   :|::||.|    :...|.:::..::.|.::.|:..:.:..:..|:     |...||.
  Fly   248 LNSKLVIGRLTASELTFWQMQLFKEFVKEQLRIRKFVQELQYLICVPVMADFI-----IFSVLIC 307

  Fly   272 ILFFA-------ENNFAMLYYAVFFAAMLIELFPSCYYGILMTMEFDKLPYAIFSSNWLKMDKRY 329
            .||||       :.::..::..:|..|.::.::.  ::..|:....|:|..|.||..|...:...
  Fly   308 FLFFALTVGVPSKMDYFFMFIYLFVMAGILWIYH--WHATLIVECHDELSLAYFSCGWYNFEMPL 370

  Fly   330 NRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTLALS 375
            .:.|:.:|.....|:.::| .:|.:::..|....|.|||::.|..|
  Fly   371 QKMLVFMMMHAQRPMKMRA-LLVDLNLRTFIDIGRGAYSYFNLLRS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 45/231 (19%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 45/231 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.