DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33a and Or49a

DIOPT Version :9

Sequence 1:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:390 Identity:83/390 - (21%)
Similarity:153/390 - (39%) Gaps:42/390 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVRSENLYKTYWLYWRLLGVEGDYPFRRLVDFTITSFITI-LFPVHLILGMYKKPQIQVFRSLHF 69
            |....:|:.|...:||.|.|.|.:....:.:|...|.:|. :.....:.|   .|...:.:.|||
  Fly    19 KTLGYDLFHTPKPWWRYLLVRGYFVLCTISNFYEASMVTTRIIEWESLAG---SPSKIMRQGLHF 80

  Fly    70 TSECLFCSYKFFCFRWKLKEIKTIEGLLQDLDSRVES-----EEERNYFNQNPSRVARMLSKSYL 129
             ...|....||..|....|.:..:...|::|....|.     |..:.|.:.:...|..:.....:
  Fly    81 -FYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRKYEVNKYYLSCSTRNVLYVYYFVMV 144

  Fly   130 VAAISAIITATVAGLFSTGR-NLMYLGWFP----YDFQ---ATAAIYWISFSYQAIGSSLLILEN 186
            |.|:..::.:.:..|...|: :..|...||    :|.:   .....|.|.|:|    |..::..:
  Fly   145 VMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPLGYVLAYVIDFTY----SQFIVNVS 205

  Fly   187 LANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQDHRKLMKIIRLLRSTLH 251
            |..|.:.......:|.|:..|...|:.|      ..|..|.:     ||...|..||:..:..:.
  Fly   206 LGTDLWMMCVSSQISMHLGYLANMLASI------RPSPETEQ-----QDCDFLASIIKRHQLMIR 259

  Fly   252 LSQ-----LGQFLSSGINISITLINILFF---AEN-NFAMLYYAVFFAAMLIELFPSCYYGILMT 307
            |.:     .|..|:|.:..:..|:..:.:   .|. |:..:.|.:.||::..:.:....:|.::.
  Fly   260 LQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFASVAAQFYVVSSHGQMLI 324

  Fly   308 MEFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTL 372
            .....|..|.|.|.|.:...||.:.::|||.....|:.|.|.|::.|.:..|...:.:.|.|:.:
  Fly   325 DLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAV 389

  Fly   373  372
              Fly   390  389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 68/327 (21%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 64/310 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465852
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.