DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33a and Or45a

DIOPT Version :9

Sequence 1:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster


Alignment Length:331 Identity:60/331 - (18%)
Similarity:126/331 - (38%) Gaps:60/331 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SYKFFCFRWKLKEIKTIEGLLQDLDSRVESEEERNYFNQNPSRVARMLSKSYLVAAISAIITATV 141
            ::||.....|.:.|.::...|..|:....:........:..:::.|.:::|:..||...|..:.:
  Fly    75 TFKFLVMMAKRRRIGSLIHRLHKLNQAASATPNHLEKIERENQLDRYVARSFRNAAYGVICASAI 139

  Fly   142 A-------GLFSTGRNLMYLGWFPYDF-----QATAAIYWISFSYQAIGSSLLILENLANDSYPP 194
            |       |...||   ::....|.:|     :.....||..:.:..:|.:......:|.|:   
  Fly   140 APMLLGLWGYVETG---VFTPTTPMEFNFWLDERKPHFYWPIYVWGVLGVAAAAWLAIATDT--- 198

  Fly   195 ITFCVVSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQDHRKLMKI-------------IRLL 246
             .|..::.:|.:....|..:..:..|:..::  :|...:..||..:.:             ::.:
  Fly   199 -LFSWLTHNVVIQFQLLELVLEEKDLNGGDS--RLTGFVSRHRIALDLAKELSSIFGEIVFVKYM 260

  Fly   247 RSTLHLSQLG-QFLSSGINISITLINILFFAENNFAMLYYAVFFAAMLIELFPSCYYGILMTMEF 310
            .|.|.|..|. :|..||.:..:.               :.|.|..|::|:|...||.|..:..:.
  Fly   261 LSYLQLCMLAFRFSRSGWSAQVP---------------FRATFLVAIIIQLSSYCYGGEYIKQQS 310

  Fly   311 DKLPYAIFSS-NWLKMDKRYNRSLIILMQLTLV----PVNIKAGGIVGIDMSAFFATVRMAYSFY 370
            ..:..|::.. ||.:|..:..|    |.|:.::    |..| .|.:..:|:......:|.|.||.
  Fly   311 LAIAQAVYGQINWPEMTPKKRR----LWQMVIMRAQRPAKI-FGFMFVVDLPLLLWVIRTAGSFL 370

  Fly   371 TLALSF 376
            .:..:|
  Fly   371 AMLRTF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 56/320 (18%)
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 56/320 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.