DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33a and Or24a

DIOPT Version :9

Sequence 1:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:422 Identity:77/422 - (18%)
Similarity:150/422 - (35%) Gaps:118/422 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LGVEGDYP-FRRLVDFTITSFITILFPVHLILGMYKKPQIQVFRSLHF--------------TSE 72
            |.:.|.|| .:|.|...:.||.....   |..|.|    .:.:..:|:              .:.
  Fly    24 LSLIGFYPEQKRTVLVKLWSFFNFFI---LTYGCY----AEAYYGIHYIPINIATALDALCPVAS 81

  Fly    73 CLFCSYKFFCFRWKLKEIKTIEGLLQDLDSRVESEEERNY---FNQNPSRVARML-------SKS 127
            .:....|.....|...|::::...::.|..:.:|:.:..|   |....:::..:|       |.|
  Fly    82 SILSLVKMVAIWWYQDELRSLIERVRFLTEQQKSKRKLGYKKRFYTLATQLTFLLLCCGFCTSTS 146

  Fly   128 YLVAAISAIITATVAG---LFSTGRNLMYLGWFPYDFQATAAIYWISFSYQAIGSSLLILENLAN 189
            |.|..:...|.....|   ::.|...:|    || |......:|                     
  Fly   147 YSVRHLIDNILRRTHGKDWIYETPFKMM----FP-DLLLRLPLY--------------------- 185

  Fly   190 DSYPPITFCVVSGHVRLLIMRLSRIGHD-----------------------------VKLSSSEN 225
                |||:.:|..|..:.::..  :|.|                             ::.|.||.
  Fly   186 ----PITYILVHWHGYITVVCF--VGADGFFLGFCLYFTVLLLCLQDDVCDLLEVENIEKSPSEA 244

  Fly   226 -----TRKLIEGIQDHRKLMKIIRLLRSTLHLSQLGQFLSSGINISITLINILFFAENNFAMLYY 285
                 .|::.:.:..|.::.::...|...:....|..|::|.:.|..::::||.|  :...::.|
  Fly   245 EEARIVREMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSLIIGTSVVDILLF--SGLGIIVY 307

  Fly   286 AVFFAAMLIELFPSCYYGILMTMEFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGG 350
            .|:..|:.:|:|..|..|..:......|..:.|||:|      |..| :.:.::||:.| .:|..
  Fly   308 VVYTCAVGVEIFLYCLGGSHIMEACSNLARSTFSSHW------YGHS-VRVQKMTLLMV-ARAQR 364

  Fly   351 IVGIDMSAF-------FATVRMAYSFYTLALS 375
            ::.|.:..|       .:.:|...|...||.|
  Fly   365 VLTIKIPFFSPSLETLTSILRFTGSLIALAKS 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 62/373 (17%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 61/361 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465152
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.