DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33a and Or10a

DIOPT Version :9

Sequence 1:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:402 Identity:84/402 - (20%)
Similarity:154/402 - (38%) Gaps:69/402 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YWRLLGVEGD-YPFRRLVDFTITSFITILFPVHLILGMYKKPQIQVFRSLHFTSEC--------L 74
            ||.  |..|| :|:|.|:.|.|.: |.:...:|..:....:.||    :|...:.|        |
  Fly    31 YWP--GKTGDTWPWRSLIHFAILA-IGVATELHAGMCFLDRQQI----TLALETLCPAGTSAVTL 88

  Fly    75 FCSYKFFCFRWKLKEI-KTIEGLLQDLDSRVESEEERNYFNQNPSRVARM----LSKSYLVAA-- 132
            ...:....||..|..: ..:.|||  .|...|..|:|:...::.:..||:    ||..:....  
  Fly    89 LKMFLMLRFRQDLSIMWNRLRGLL--FDPNWERPEQRDIRLKHSAMAARINFWPLSAGFFTCTTY 151

  Fly   133 -ISAIITATVAGL--------------FSTGRNLMYLGWFPYDFQATAAIYWIS----------- 171
             :..|:.|.:..|              .:..:.|:...:||..:...|...:::           
  Fly   152 NLKPILIAMILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPLTYIFIAYTGYVTIFMFGGCDGFY 216

  Fly   172 FSYQAIGSSLL-ILENLANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQD 235
            |.:.|..|:|. :|:......:.|.|..:....|:|.|:.                :|:...|..
  Fly   217 FEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYILE----------------QKMRSVIIR 265

  Fly   236 HRKLMKIIRLLRSTLHLSQLGQFLSSGINISITLINILFFAENNFAMLYYAVFFAAMLIELFPSC 300
            |..::.:.|..|....:..|..|:|:.:.|..:::|:|....|....:.|..:..|.|.:|...|
  Fly   266 HNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYC 330

  Fly   301 YYGILMTMEFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRM 365
            |.|.|:......|..|:||..|.....:..|.:.:|:..:..||:: |.......::.|.|.::.
  Fly   331 YGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM-AVPFFSPSLATFAAILQT 394

  Fly   366 AYSFYTLALSFR 377
            :.|...|..||:
  Fly   395 SGSIIALVKSFQ 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 67/347 (19%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 68/348 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465116
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.