DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33a and Or9a

DIOPT Version :9

Sequence 1:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:395 Identity:83/395 - (21%)
Similarity:151/395 - (38%) Gaps:62/395 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LYWRLLGVE-------GDYPFRRLVDFTITSFITI----LFPVHLILGMYKK-PQIQVFRSL--- 67
            |.:|.:|::       .|.|:        .:|:|:    ||.|.:.|..::. .|:.:....   
  Fly    22 LVYRCMGIDLWSPTMANDRPW--------LTFVTMGPLFLFMVPMFLAAHEYITQVSLLSDTLGS 78

  Fly    68 HFTSECLFCSYKFFCFRWK-----LKEIKTIEGLLQDLDSRVESEEERNYFNQNPSRVARMLSKS 127
            .|.|......:..||:..|     :..|:.|  |.::::...::.|.....||:...::...::.
  Fly    79 TFASMLTLVKFLLFCYHRKEFVGLIYHIRAI--LAKEIEVWPDAREIIEVENQSDQMLSLTYTRC 141

  Fly   128 YLVAAISAIITATVAGLFSTGR------NLMYLGWFPYDFQA----TAAIYW-ISFSYQAIGSSL 181
            :.:|.|.|.:...|..:.|:.|      .|.:.|.:|||.|.    .....| :..||.|:..:|
  Fly   142 FGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQVVMFYVPTYLWNVMASYSAVTMAL 206

  Fly   182 LILENLANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQDHRKLMKIIRLL 246
            .:...|...:|.......::.|         |:.|...:...|....|::.:..|:|.::|...:
  Fly   207 CVDSLLFFFTYNVCAIFKIAKH---------RMIHLPAVGGKEELEGLVQVLLLHQKGLQIADHI 262

  Fly   247 RSTLHLSQLGQFLSSGINISITLINI--LFFAENNFAMLYYAVFFAAMLIELF--PSCYYGI-LM 306
            ..........||..|.:.|......:  ||   .|...||:..|..::||.||  ..|...| ..
  Fly   263 ADKYRPLIFLQFFLSALQICFIGFQVADLF---PNPQSLYFIAFVGSLLIALFIYSKCGENIKSA 324

  Fly   307 TMEFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYT 371
            :::|..   .::.:||........|:|:|.......|..:| |......|:.|...||.|.|:..
  Fly   325 SLDFGN---GLYETNWTDFSPPTKRALLIAAMRAQRPCQMK-GYFFEASMATFSTIVRSAVSYIM 385

  Fly   372 LALSF 376
            :..||
  Fly   386 MLRSF 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 67/329 (20%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 68/330 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.