DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33a and Or65a

DIOPT Version :9

Sequence 1:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:360 Identity:59/360 - (16%)
Similarity:132/360 - (36%) Gaps:99/360 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 YFNQNPSRVARMLSKSYLVA-----AISAI---ITATVAGLFSTGRNLMYL-------------- 154
            |.|....|:.|:::..|.|:     |::::   |:.::..:.:.||:|:::              
  Fly    52 YMNSEQRRLPRIVAWQYFVSIQLATALASLFYGISESIGDIVNLGRDLVFIITIIFICFRLVFFA 116

  Fly   155 ----------------------GWFPYDFQATAAIYWISFSYQAI-GSSLLILENLANDSYP--- 193
                                  |....:.|.|..::::.|....| ..|.|||..|...|.|   
  Fly   117 QYAGELDVIIDALEDIYHWSIKGPATKEVQETKRLHFLLFMALIITWFSFLILFMLIKISTPFWI 181

  Fly   194 ---------------------PITFCV--VSGHVRLLIMRL-----SRIGHDV--KLSSS----- 223
                                 ||.:.:  ||....:|...:     ..:|..:  :|:|:     
  Fly   182 ESQTLPFHVSWPFQLHDPSKHPIAYIIIFVSQSTTMLYFLIWLGVVENMGVSLFFELTSALRVLC 246

  Fly   224 ---ENTRKLIEGIQD--HRKLMKIIRLLRSTLHLSQ----------LGQFLSSGINISITLINIL 273
               .|.::|..|.:|  :|:|.::.:..:..:.|:.          :.|.|.:.:.:|::|..:|
  Fly   247 IELRNLQELCLGDEDMLYRELCRMTKFHQQIILLTDRCNHIFNGAFIMQMLINFLLVSLSLFEVL 311

  Fly   274 FFAENNFAMLYYAVFFAAMLIELFPSCYYGILMTMEFDKLPYAIFSSNWLKM-DKRYNRSLIILM 337
            ...:|....:.|.:.....|..|.....:|.:.:.|.:::..|::.:....: .|..:|.....:
  Fly   312 AAKKNPQVAVEYMIIMLMTLGHLSFWSKFGDMFSKESEQVALAVYEAYDPNVGSKSIHRQFCFFI 376

  Fly   338 QLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTL 372
            |....|:.:||......::..:...::..||..|:
  Fly   377 QRAQKPLIMKASPFPPFNLENYMFILKQCYSILTI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 56/353 (16%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 44/260 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465242
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.