DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or33a and Or69a

DIOPT Version :9

Sequence 1:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:326 Identity:73/326 - (22%)
Similarity:131/326 - (40%) Gaps:60/326 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 WKLKEIKT-IEGLLQDLDSRVESEEERNY----FNQNPSRVAR---MLSKSYLVAAISAIITATV 141
            ||:..:|| .|.||.:.:...:..:.|.|    :.:..:|..|   :...|.:|...|..|...:
  Fly    95 WKMLSLKTHFENLLNEFEELFQLIKHRAYRIHHYQEKYTRHIRNTFIFHTSAVVYYNSLPILLMI 159

  Fly   142 AGLFSTGRNLMYL----GWFPYDFQAT-----AAIYWISFSYQAIGSSLLILENLANDSYPPITF 197
            ...||..:.|.|.    .|:|:..|.:     ||:....||.|.         |:..:.:  |.|
  Fly   160 REHFSNSQQLGYRIQSNTWYPWQVQGSIPGFFAAVACQIFSCQT---------NMCVNMF--IQF 213

  Fly   198 CV------VSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQDHRKLMKIIRLLRSTLHLSQLG 256
            .:      :..|...|..:|..|  |.:...:::..|.:  |..|.||:.:...:..:.:.:.| 
  Fly   214 LINFFGIQLEIHFDGLARQLETI--DARNPHAKDQLKYL--IVYHTKLLNLADRVNRSFNFTFL- 273

  Fly   257 QFLSSGINISITLINILFFAENNFAMLYYAVFFAAMLIEL----------FPSCYYGILMTMEFD 311
                  |::|:::|:..|.|   |:|..:.  |...|..|          |..|..|..:.:...
  Fly   274 ------ISLSVSMISNCFLA---FSMTMFD--FGTSLKHLLGLLLFITYNFSMCRSGTHLILTSG 327

  Fly   312 KLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTLALSF 376
            |:..|.|.:||.:.|..|.|.|:|||.....|...|...:..:.::.:.||::.:|..:|...|.
  Fly   328 KVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFTCVRSL 392

  Fly   377 R 377
            :
  Fly   393 K 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 70/314 (22%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 70/314 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.