DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B2 and amy2al1

DIOPT Version :9

Sequence 1:NP_001188791.2 Gene:Mal-B2 / 34598 FlyBaseID:FBgn0032382 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_956722.1 Gene:amy2al1 / 393400 ZFINID:ZDB-GENE-040426-1606 Length:512 Species:Danio rerio


Alignment Length:553 Identity:108/553 - (19%)
Similarity:176/553 - (31%) Gaps:236/553 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RYLADTGITATWLSPIFQSPMI------------DFGYDISDYKAIQPEYGTMQDFEELIDTAFE 119
            ||||..|.....:||..:|.::            ...|::..      ..||.::.:::|.....
Zfish    45 RYLAPNGYGGVQISPPSESIVLTKPWHPWWQRYQPISYNLCS------RSGTEEELKDMIARCNN 103

  Fly   120 LGIKVVLDFVPNHSSDQHEWFKKSAAREPGYEDFYVWHDGIVQENGTRVPPNN--WPSVFYGSAW 182
            :|:.:..|.|.||          ......|        :|.....||.....|  :|||.| |:|
Zfish   104 VGVNIYADAVINH----------MCGASGG--------EGTHSSCGTYFNAKNEDFPSVPY-SSW 149

  Fly   183 EWHEGREQYYLHQFTKEQPDLNY------RNPKVVQAMDDVL---------LFWLNK----GVAG 228
            ::::.:.:      |..:...||      |:.::|..:|..|         ..::||    ||||
Zfish   150 DFNDNKCK------TANEDIENYSDIFQVRDCRLVSLLDLALEKDYVRGKVAEYMNKLIDIGVAG 208

  Fly   229 FRIDAVNHLFEDESLKDEPLSGKTTDSLSYDYTKHIYSRDLPEVLEMIHH-WRQLLDDFSAKHPE 292
            ||:||..|::..:                   ..::|||     |:.::: |      ||.    
Zfish   209 FRVDACKHMWPGD-------------------LSNVYSR-----LKTLNNTW------FSP---- 239

  Fly   293 RPTRIMMTEAYAGLTQLADYYEDSNGVRGSHLPFNFHFITDVKGDS-DARDYV---------YN- 346
                                     |.:    ||.:..:.|:.|:. .|.:||         |: 
Zfish   240 -------------------------GTK----PFIYQEVIDLGGEPIKASEYVSLGRVTEFKYSA 275

  Fly   347 -----VEKW----LIYMPRGHAANWVMG--------------NHDNPRVASRFGPASV----DAM 384
                 :.||    |.|:     .||..|              ||||.| ....|.|||    |:.
Zfish   276 KLGTVIRKWEKEKLCYL-----KNWGEGWGFMPSDKALVFVDNHDNQR-GHGAGGASVLTFWDSR 334

  Fly   385 NMLLLTLPGVAVTYNGEELGMVDYRELSWE----------ETVDPPARNVGEKLYQEVSRDPVRT 439
            ...:.|...:|..| |....|..||   |:          :.:.||:...|......::.|    
Zfish   335 LYKIATGLMLAHPY-GVTAVMSSYR---WDRHFVNGKDQNDWMGPPSNADGSTKSVPINPD---- 391

  Fly   440 PFQWNNETNAGFSTAAKTWLPVHPNYLELNLEAQKVANRSHYQVYKDLLELRKSAIMRVGRFNIE 504
                        ||....|:..|                 .::..::::..|...       |.:
Zfish   392 ------------STCGDNWICEH-----------------RWRQIRNMVNFRNVV-------NGQ 420

  Fly   505 PLTRW------VFAFKRSYPNFESIITVINVSD 531
            ||:.|      ..||.|....|    .|||.:|
Zfish   421 PLSNWWDNNNNQIAFSRGSKGF----IVINNND 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B2NP_001188791.2 AmyAc_maltase 33..502 CDD:200467 96/516 (19%)
Malt_amylase_C 510..>541 CDD:351862 8/22 (36%)
amy2al1NP_956722.1 AmyAc_bac_euk_AmyA 25..417 CDD:200456 96/508 (19%)
AmyA 46..>315 CDD:223443 69/367 (19%)
Aamy_C 424..511 CDD:214749 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576524
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.