DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B2 and R01B10.3

DIOPT Version :9

Sequence 1:NP_001188791.2 Gene:Mal-B2 / 34598 FlyBaseID:FBgn0032382 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_504566.1 Gene:R01B10.3 / 178991 WormBaseID:WBGene00019805 Length:98 Species:Caenorhabditis elegans


Alignment Length:158 Identity:32/158 - (20%)
Similarity:50/158 - (31%) Gaps:71/158 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 TDSLS-------YDYTK--HIYSRDLPEVLEMIHHWRQLLDDFSAKHPERPTRIMMTEAYAGLTQ 308
            |||::       |.|..  .:..|.:.||.::.:.    ||:.:||..|...|:      |..|.
 Worm     3 TDSVTDSCCSSEYSYCSCDCVKQRKVAEVPQIGYS----LDELNAKREEPKWRV------ARYTA 57

  Fly   309 LADYYEDSNGVRGSHLPFNFHFITDVKGDSDARDYVYNVEKWLIYMPRGHAANWVMGNHDNPRVA 373
            :|.::    |:.|:.|..:...|                               |:.|||   ||
 Worm    58 IAMFW----GIWGALLAGSILII-------------------------------VLNNHD---VA 84

  Fly   374 SRFGPASVDAMNMLLLTLPGVAVTYNGE 401
            |              .|......|.||:
 Worm    85 S--------------TTAAPTTTTTNGQ 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B2NP_001188791.2 AmyAc_maltase 33..502 CDD:200467 32/158 (20%)
Malt_amylase_C 510..>541 CDD:351862
R01B10.3NP_504566.1 SLC3A2_N 35..>79 CDD:374310 14/88 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.