DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B1 and SBE2.2

DIOPT Version :9

Sequence 1:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_195985.3 Gene:SBE2.2 / 831769 AraportID:AT5G03650 Length:805 Species:Arabidopsis thaliana


Alignment Length:393 Identity:81/393 - (20%)
Similarity:141/393 - (35%) Gaps:116/393 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LQYFKDTGITSVWLSPIYE-SPMVDFGYDISNYTNIQPEYGTLEDFDALIAKANELGVKVILDFV 128
            |...|..|..:|.:..|.| |....|||.::|:.......||.|:..:||.:|:|||:.|::|.|
plant   318 LPRIKKLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRCGTPEELKSLIDRAHELGLVVLMDIV 382

  Fly   129 PNHSSNKHPWFIKSVAREPGYEDFYVWEDGILLENGTRVPPNNWLSVFSGSAWMWNDERQQYYLR 193
            .:|:|       |:..            ||:.:.:||  ..:.:.|...|..|||:.       |
plant   383 HSHAS-------KNTL------------DGLNMFDGT--DAHYFHSGPRGYHWMWDS-------R 419

  Fly   194 QFTYGQPDLNYRNPAVIKAMDDVMLFWLNK-GIAGFRIDAIIYIYEDAQLRDEPPSGTTDDPNNE 257
            .|.||..:       |::.:.....:||.: ...|||.|                 |.|......
plant   420 LFNYGSWE-------VLRYLLSNARWWLEEYKFDGFRFD-----------------GVTSMMYTH 460

  Fly   258 AYLSHIYTRNQPEDYGLLQHWRQLLDNYTANHDGPLRIMMTEG--YASVSQLMEYYEDSNGVQGP 320
            ..||..:|.|..|.:||           ..:.|....:|:...  :....:.:...||.:|:  |
plant   461 HGLSVGFTGNYTEYFGL-----------ETDVDAVNYLMLVNDMIHGLYPEAITVGEDVSGM--P 512

  Fly   321 QF-------PFNFDF-------------ITELNANSTAADFVFYIS--RW---LIYMPHGH---- 356
            .|       ...||:             :.:.:.:....|.::.::  ||   .|.....|    
plant   513 TFCIPVQDGGVGFDYRLHMAIADKWIEMLKKRDEDWQMGDIIYTLTNRRWSEKCISYAESHDQAL 577

  Fly   357 -----VANWVMGNH-------DNPRVASRFGEKSVDAMNMLLMTLPGIG----ITYNGEELGMTD 405
                 :|.|:|...       |.|  ::...::.:....|:.:...|:|    :.:.|.|.|..:
plant   578 VGDKTIAFWLMDKDMYDFMAVDRP--STPLIDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPE 640

  Fly   406 YRD 408
            :.|
plant   641 WID 643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 81/393 (21%)
trehalose_treC 33..538 CDD:274115 81/393 (21%)
SBE2.2NP_195985.3 PLN02447 61..805 CDD:215246 81/393 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.