DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B1 and SBE2.1

DIOPT Version :9

Sequence 1:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_181180.1 Gene:SBE2.1 / 818212 AraportID:AT2G36390 Length:858 Species:Arabidopsis thaliana


Alignment Length:405 Identity:83/405 - (20%)
Similarity:147/405 - (36%) Gaps:130/405 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LQYFKDTGITSVWLSPIYE-SPMVDFGYDISNYTNIQPEYGTLEDFDALIAKANELGVKVILDFV 128
            |...|..|..:|.:..|.| :....|||.::|:......:||.:|..:||.||:|||:.|::|.|
plant   353 LPRIKKLGYNAVQIMAIQEHAYYASFGYHVTNFFAPSSRFGTPDDLKSLIDKAHELGLVVLMDIV 417

  Fly   129 PNHSSNKHPWFIKSVAREPGYEDFYVWEDGILLENGTRVPPNNWLSVFSGSAWMWNDERQQYYLR 193
            .:|:|..         ...|. |.:...||....:|:|           |..|||:.       |
plant   418 HSHASKN---------TLDGL-DMFDGTDGQYFHSGSR-----------GYHWMWDS-------R 454

  Fly   194 QFTYGQPDLNYRNPAVIKAMDDVMLFWLNK-GIAGFRIDAI---IYIYEDAQLRDEPPSGTTDDP 254
            .|.||..:       |::.:.....:||.: ...|||.|.:   :|.:...|:.           
plant   455 LFNYGSWE-------VLRYLLSNARWWLEEYKFDGFRFDGVTSMMYTHHGLQVE----------- 501

  Fly   255 NNEAYLSHIYTRNQPEDYGLLQHWRQLLDNYTANHDGPLRIMMTEG--YASVSQLMEYYEDSNGV 317
                     :|.|..|.:|           |:.:.|..:.:|:...  :....:.:...||.:|:
plant   502 ---------FTGNYNEYFG-----------YSTDVDAVVYLMLVNDLIHGLYPEAIVVGEDVSGM 546

  Fly   318 QGPQF-------PFNFDF-------------ITELNANSTAADFVFYIS--RW----LIYMPHGH 356
              |.|       ...||:             :.:.:.:....|..|.::  ||    ::| ...|
plant   547 --PAFCVPVEDGGVGFDYRLHMAVADKWIELLKKRDEDWQVGDITFTLTNRRWGEKCVVY-AESH 608

  Fly   357 ---------VANWVMGN--HD--------NPRVASRFGEKSVDAMNMLLMTLPGIG----ITYNG 398
                     :|.|:|..  :|        .|||     ::.:....|:.:...|:|    :.:.|
plant   609 DQALVGDKTIAFWLMDKDMYDFMAVDRQATPRV-----DRGIALHKMIRLITMGLGGEGYLNFMG 668

  Fly   399 EELGMTDYRDISWSD 413
            .|.|..::.|...:|
plant   669 NEFGHPEWIDFPRTD 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 83/405 (20%)
trehalose_treC 33..538 CDD:274115 83/405 (20%)
SBE2.1NP_181180.1 PLN02447 150..830 CDD:215246 83/405 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.