DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B1 and SLC3A2

DIOPT Version :9

Sequence 1:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001012680.1 Gene:SLC3A2 / 6520 HGNCID:11026 Length:631 Species:Homo sapiens


Alignment Length:590 Identity:117/590 - (19%)
Similarity:199/590 - (33%) Gaps:186/590 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GLVGILAHKHQSKELDAKYNWWQHEVFYQIYPRSFQDSNGDGIGDLQGITSRLQYFKDTGITSVW 77
            |.|.|:....:.:||.|: .||.....|:|  ...|...|.|.|:|.|:..||.|.....:..:.
Human   200 GAVVIIVRAPRCRELPAQ-KWWHTGALYRI--GDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLV 261

  Fly    78 LSPIYESPMVDFGYDISNYTNIQPEYGTLEDFDALIAKANELGVKVILDFVPNHSSNKHPWFIKS 142
            |.||:::...|...  ::...|.|.:|:.||||:|:..|.:..::||||..||:...        
Human   262 LGPIHKNQKDDVAQ--TDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGE-------- 316

  Fly   143 VAREPGYEDFYVWEDGILLENGTRVPPNNWLSVFSGSAWMWNDERQQYYLRQFTYGQPDLNYRNP 207
                                       |:|.|.                       |.|      
Human   317 ---------------------------NSWFST-----------------------QVD------ 325

  Fly   208 AVIKAMDDVMLFWLNKGIAGFRI-------DAIIYIYEDAQLRDEPPSGTTDDPNNEAYLSHIYT 265
            .|...:.|.:.|||..|:.||::       ||..::.|...:                      |
Human   326 TVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNI----------------------T 368

  Fly   266 RNQPEDYGLL-----QHWRQLLDNYTANHDGPLRIMMTEGYASVSQLMEYYEDSNGVQGPQFPFN 325
            :...||..|:     ...:|:|....:|.|    :::|..|.|.|             |......
Human   369 KGFSEDRLLIAGTNSSDLQQILSLLESNKD----LLLTSSYLSDS-------------GSTGEHT 416

  Fly   326 FDFITE-LNANSTAADFVFYISRWLIYMPHGHVANWVMGNHDNPRVASRF-GEKSVDAMNMLLMT 388
            ...:|: |||..         :||         .:|.:   ...|:.:.| ..:.:....::|.|
Human   417 KSLVTQYLNATG---------NRW---------CSWSL---SQARLLTSFLPAQLLRLYQLMLFT 460

  Fly   389 LPGIGITYNGEELGMTDYRDISWSDTVDQPACEAGIDNYKTISRDPERTP-MQWSSDVNAGFSSA 452
            |||..:...|:|:|:         |....|.             .|...| |.|           
Human   461 LPGTPVFSYGDEIGL---------DAAALPG-------------QPMEAPVMLW----------- 492

  Fly   453 DRTWLPVNPNYKELNL--RNQQQARRSHYKIYQSLLKLRQLP-VLKNGSFVPEVVNRRVFAFKRE 514
            |.:..|..|.....|:  :.|.:...|...:::.|...|... .|.:|.|........:|::.|.
Human   493 DESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRH 557

  Fly   515 LKNEHTLLTIVN-----VSNRTELVDIADFIEQPNRLSVLVAGVDSQHRVGDRLKAETIELAPNE 574
            .......|.::|     :|...:..|:......|.:..:|::....:.. |..|:.|.::|.|:|
Human   558 WDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREE-GSPLELERLKLEPHE 621

  Fly   575 GLVIQ 579
            ||:::
Human   622 GLLLR 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 94/487 (19%)
trehalose_treC 33..538 CDD:274115 101/527 (19%)
SLC3A2NP_001012680.1 SLC3A2_N 161..225 CDD:292647 8/25 (32%)
AmyAc_SLC3A2 208..537 CDD:200483 95/490 (19%)
AmyA 238..597 CDD:223443 96/517 (19%)
DUF3459 520..625 CDD:288769 21/105 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143608
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.