DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B1 and amy2al2

DIOPT Version :9

Sequence 1:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001003729.1 Gene:amy2al2 / 445049 ZFINID:ZDB-GENE-040801-179 Length:512 Species:Danio rerio


Alignment Length:444 Identity:90/444 - (20%)
Similarity:154/444 - (34%) Gaps:160/444 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DGIGDLQGITSRLQYFKDTGITSVWLSPIYESPMVDFGYDISNYTNIQPEYGTLEDFDALIAKAN 117
            :|.|.:| |:...::.|   :|:.| .|.::.      |...:| |:....||..:...:|.:.|
Zfish    50 NGYGGVQ-ISPPSEHVK---LTNPW-HPWWQR------YQPISY-NLCSRSGTEAELKDMITRCN 102

  Fly   118 ELGVKVILDFVPNHSSNKHPWFIKSV--AREP---------GYEDFYVWEDGILLENGTRVPPNN 171
            .:||.:..|.|.||       ..||:  |..|         ..|||             ...|.:
Zfish   103 NVGVNIYADVVINH-------MCKSIHGAGTPSSCGSHFDANKEDF-------------PTVPYS 147

  Fly   172 WLSVFSGSAWMWNDERQQYYLRQFTYGQPDLNYRNPAVIKAMDDVML----------FWLNK--- 223
            :|....|.....:.:.:.|         .|:.......::.:.|:.|          .:|||   
Zfish   148 YLDFNDGKCKSASGQIESY---------NDIYQVRDCRLEDLLDLALEKDYVRGKVAEYLNKLIE 203

  Fly   224 -GIAGFRIDA--------IIYIYEDAQLRDEP--PSGTT-----------DDP--NNEAY-LSHI 263
             |:||||:||        :..:|...:..:..  ||||.           .:|  .:|.| |:.:
Zfish   204 LGVAGFRVDACKHMWPGDLSNVYSRLKTLNTKWFPSGTKPFIYQEVIDLGGEPIKASEYYGLARV 268

  Fly   264 ----------------------YTRNQPEDYGLLQHWRQLLDNYTANHD-------GPLRIM--- 296
                                  |.:|..|.:|.:...:.|:  :..|||       |...::   
Zfish   269 TEFKHSAKIGTAVRKWDGEKLSYLKNWGEGWGFMPSDKALV--FVDNHDNQRGHGAGGASVLTFW 331

  Fly   297 ------MTEGYA-----SVSQLMEYYE---------DSNGVQGPQFPFNFDFITE---LNANSTA 338
                  |..|:.     .|:::|..|:         |.|...||  |...|..|:   :|.:||.
Zfish   332 DSRLYKMAAGFMLAHPYGVTRVMSSYQWDRKIVNGKDENDWMGP--PSFSDGSTKPVPINPDSTC 394

  Fly   339 ADFVFYISRW------LIY--MPHGH-VANWVMGNHDNPRVASRFGEKSVDAMN 383
            .|......||      :|:  :.:|. :.||  .::.|.::|...|.|....:|
Zfish   395 GDGWVCEHRWRQIRNMVIFRNVVNGQPLFNW--WDNGNSQIAFSRGSKGFIVIN 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 90/444 (20%)
trehalose_treC 33..538 CDD:274115 90/444 (20%)
amy2al2NP_001003729.1 AmyAc_bac_euk_AmyA 25..417 CDD:200456 82/411 (20%)
Aamy_C 424..511 CDD:214749 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576525
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.