DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B1 and slc3a2b

DIOPT Version :9

Sequence 1:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_958922.2 Gene:slc3a2b / 399488 ZFINID:ZDB-GENE-040122-2 Length:504 Species:Danio rerio


Alignment Length:580 Identity:112/580 - (19%)
Similarity:198/580 - (34%) Gaps:187/580 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GLVGILAHKHQSKELDAKYNWWQHEVFYQIYPRSFQDSNGDGIG------DLQGITSRLQYFKDT 71
            |.:.|:....:.|.| .:.|||.:...|||         || :|      |::.:..::|...|.
Zfish    94 GAIAIIIQAPRCKPL-PEMNWWNNGPLYQI---------GD-VGAFTNSSDIKDLAGKVQALDDL 147

  Fly    72 GITSVWLSPIYESPMVDFGYDISNYTN---IQPEYGTLEDFDALIAKANELGVKVILDFVPNHSS 133
            .:..:.:.||:.|     ..|..|..|   |..:.|.|..|..:|..|::.|:.||||..||: .
Zfish   148 KVKGLIIGPIHVS-----SEDKPNELNLIKISEDDGVLAQFKEVITAAHKRGISVILDLTPNY-K 206

  Fly   134 NKHPWFIKSVAREPGYEDFYVWEDGILLENGTRVPPNNWLSVFSGSAWMWNDERQQYYLRQFTYG 198
            .|.|||..:|                                                       
Zfish   207 GKDPWFSDAV------------------------------------------------------- 216

  Fly   199 QPDLNYRNPAVIKAMDDVMLFWLNKGIAGFRIDAIIYIYEDAQLRDEPPSGTTDDPNNEAYLSHI 263
                     ..::.::..::|||.:|:.||      ..|...::....|:..:|    ...|.| 
Zfish   217 ---------NTVQKVEPALIFWLKQGVDGF------LFYGVEKVAAAAPTFWSD----VVALIH- 261

  Fly   264 YTRNQPEDYGLLQHWRQLLDNYTANHDGPLRIMMTEGYASVSQLMEYYEDSNGVQGPQFPFNFDF 328
               ||.:..|   ..:::|...| :...|..|..|.....|..|:.....|..||          
Zfish   262 ---NQTDAEG---KTKKVLIGVT-DQSSPEEISATLNKTGVDLLLSGALRSKSVQ---------- 309

  Fly   329 ITELNANSTAADFVFYISRWLIYMPHGHVANWVMGNHDNPRVASRFGEKSVDAMNMLLMTLPGIG 393
              |: |.:..:.:..|....|.         |.:|......:||..|...|....::|:||||..
Zfish   310 --EV-AQAVESLYSTYNQTRLA---------WNIGGRIAGHLASVVGFAKVKLSQLMLLTLPGTP 362

  Fly   394 ITYNGEELGMTDYRDISWSDTVDQPACEAGIDNYKTISRDPERTPMQWSSDVNAGFSSADRTWLP 458
            :...|:|:|:.|                 .::.|.|         |.|                 
Zfish   363 VFNYGDEIGLED-----------------EVNKYPT---------MLW----------------- 384

  Fly   459 VNPNYKELNLRNQQQARRSHYKIYQSL-LKLRQLPVLKNGSFVPEVVNRRVFAFKREL-KNEHTL 521
                  :.|...:|:...:::..::|: :|..:...|::|.::|...:....|:.|.. :||..|
Zfish   385 ------KFNDEEKQKEMSTYHSFFKSVSVKRMKERSLQHGEYLPLFNSDFAMAYVRSWDQNERYL 443

  Fly   522 LTIVNVSNRTELVDI--ADFIEQPNRLSVLVAGVDSQHRVGDRLKAETIELAPNEGLVIQ 579
            :.:...||.|..:.:  ||..|.    :.:|.....:..|...|....:|:.|.||::::
Zfish   444 IALNWHSNETVSLQLKHADIPES----ATVVFSTSGETEVNKELNLAQLEVNPGEGIMLK 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 89/479 (19%)
trehalose_treC 33..538 CDD:274115 97/517 (19%)
slc3a2bNP_958922.2 SLC3A2_N 49..119 CDD:292647 7/25 (28%)
AmyAc_SLC3A2 103..415 CDD:200483 89/481 (19%)
AmyA 133..471 CDD:223443 92/500 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576550
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.