DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B1 and amy2al1

DIOPT Version :9

Sequence 1:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_956722.1 Gene:amy2al1 / 393400 ZFINID:ZDB-GENE-040426-1606 Length:512 Species:Danio rerio


Alignment Length:518 Identity:106/518 - (20%)
Similarity:163/518 - (31%) Gaps:203/518 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QYFKDTGITSVWLSPIYESPMVD-------FGYDISNYTNIQPEYGTLEDFDALIAKANELGVKV 123
            :|....|...|.:||..||.::.       ..|...:| |:....||.|:...:||:.|.:||.:
Zfish    45 RYLAPNGYGGVQISPPSESIVLTKPWHPWWQRYQPISY-NLCSRSGTEEELKDMIARCNNVGVNI 108

  Fly   124 ILDFVPNH----------SSNKHPWFIKSVAREPGYEDFYVWEDGILLENGTRVPPNNWLSVFSG 178
            ..|.|.||          .|:...:|      ....|||            ..||         .
Zfish   109 YADAVINHMCGASGGEGTHSSCGTYF------NAKNEDF------------PSVP---------Y 146

  Fly   179 SAWMWNDERQQYYLRQFTYGQPDLNY------RNPAVIKAMD---------DVMLFWLNK----G 224
            |:|.:||.:.:      |..:...||      |:..::..:|         ..:..::||    |
Zfish   147 SSWDFNDNKCK------TANEDIENYSDIFQVRDCRLVSLLDLALEKDYVRGKVAEYMNKLIDIG 205

  Fly   225 IAGFRIDAI----------IY------------------IYEDA-QLRDEP-------PSGTTDD 253
            :||||:||.          :|                  ||::. .|..||       ..|...:
Zfish   206 VAGFRVDACKHMWPGDLSNVYSRLKTLNNTWFSPGTKPFIYQEVIDLGGEPIKASEYVSLGRVTE 270

  Fly   254 PNNEAYLSHI----------YTRNQPEDYGLLQHWRQLLDNYTANHDG----------------- 291
            ....|.|..:          |.:|..|.:|.:...:.|:  :..|||.                 
Zfish   271 FKYSAKLGTVIRKWEKEKLCYLKNWGEGWGFMPSDKALV--FVDNHDNQRGHGAGGASVLTFWDS 333

  Fly   292 -----PLRIMMTEGYASVSQLMEYY---------EDSNGVQGPQFPFNFDFITE---LNANSTAA 339
                 ...:|:...| .|:.:|..|         :|.|...||  |.|.|..|:   :|.:||..
Zfish   334 RLYKIATGLMLAHPY-GVTAVMSSYRWDRHFVNGKDQNDWMGP--PSNADGSTKSVPINPDSTCG 395

  Fly   340 DFVFYISRW--------LIYMPHGH-VANWVMGNHDNPRVASRFGEKSVDAMN--------MLLM 387
            |......||        ...:.:|. ::||  .:::|.::|...|.|....:|        ||..
Zfish   396 DNWICEHRWRQIRNMVNFRNVVNGQPLSNW--WDNNNNQIAFSRGSKGFIVINNNDWDLNVMLKT 458

  Fly   388 TLPGIGITYNGEELGMTDYRDISWSD-----------TVDQPA------CEAGIDNYKTISRD 433
            .||.            ..|.||...|           |||...      |....|.:..|..|
Zfish   459 GLPS------------GTYCDIISGDKSGNSCTGKQVTVDSDGQATFSICHTEEDPFMAIHAD 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 106/518 (20%)
trehalose_treC 33..538 CDD:274115 106/518 (20%)
amy2al1NP_956722.1 AmyAc_bac_euk_AmyA 25..417 CDD:200456 83/410 (20%)
AmyA 46..>315 CDD:223443 62/304 (20%)
Aamy_C 424..511 CDD:214749 22/100 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576526
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.